Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   SD459_RS12295 Genome accession   NZ_CP138627
Coordinates   2490242..2490415 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain AYGS-17     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2485242..2495415
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SD459_RS12280 (SD459_12275) gcvT 2486055..2487155 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  SD459_RS12285 (SD459_12280) - 2487579..2489249 (+) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  SD459_RS12290 (SD459_12285) - 2489271..2490065 (+) 795 WP_014418368.1 YqhG family protein -
  SD459_RS12295 (SD459_12290) sinI 2490242..2490415 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  SD459_RS12300 (SD459_12295) sinR 2490449..2490784 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  SD459_RS12305 (SD459_12300) tasA 2490832..2491617 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  SD459_RS12310 (SD459_12305) sipW 2491682..2492266 (-) 585 WP_014418370.1 signal peptidase I SipW -
  SD459_RS12315 (SD459_12310) tapA 2492238..2492909 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  SD459_RS12320 (SD459_12315) - 2493168..2493497 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  SD459_RS12325 (SD459_12320) - 2493538..2493717 (-) 180 WP_003153093.1 YqzE family protein -
  SD459_RS12330 (SD459_12325) comGG 2493774..2494151 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  SD459_RS12335 (SD459_12330) comGF 2494152..2494547 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  SD459_RS12340 (SD459_12335) comGE 2494561..2494875 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  SD459_RS12345 (SD459_12340) comGD 2494859..2495296 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=903744 SD459_RS12295 WP_014418369.1 2490242..2490415(+) (sinI) [Bacillus velezensis strain AYGS-17]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=903744 SD459_RS12295 WP_014418369.1 2490242..2490415(+) (sinI) [Bacillus velezensis strain AYGS-17]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719