Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ABI226_RS13415 Genome accession   NZ_CP157216
Coordinates   2560746..2561129 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   P25958
Organism   Bacillus subtilis subsp. subtilis isolate FELIX_MS22     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2555746..2566129
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABI226_RS13375 (ABI226_13375) sinI 2556680..2556853 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  ABI226_RS13380 (ABI226_13380) sinR 2556887..2557222 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ABI226_RS13385 (ABI226_13385) tasA 2557315..2558100 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  ABI226_RS13390 (ABI226_13390) sipW 2558164..2558736 (-) 573 WP_003246088.1 signal peptidase I -
  ABI226_RS13395 (ABI226_13395) tapA 2558720..2559481 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  ABI226_RS13400 (ABI226_13400) yqzG 2559753..2560079 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ABI226_RS13405 (ABI226_13405) spoIIT 2560121..2560300 (-) 180 WP_003230176.1 YqzE family protein -
  ABI226_RS13410 (ABI226_13410) comGG 2560371..2560745 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  ABI226_RS13415 (ABI226_13415) comGF 2560746..2561129 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  ABI226_RS13420 (ABI226_13420) comGE 2561155..2561502 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  ABI226_RS13425 (ABI226_13425) comGD 2561486..2561917 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  ABI226_RS13430 (ABI226_13430) comGC 2561907..2562203 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ABI226_RS13435 (ABI226_13435) comGB 2562217..2563254 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  ABI226_RS13440 (ABI226_13440) comGA 2563241..2564311 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ABI226_RS13445 (ABI226_13445) corA 2564723..2565676 (-) 954 WP_032723504.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=903195 ABI226_RS13415 WP_003230168.1 2560746..2561129(-) (comGF) [Bacillus subtilis subsp. subtilis isolate FELIX_MS22]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=903195 ABI226_RS13415 WP_003230168.1 2560746..2561129(-) (comGF) [Bacillus subtilis subsp. subtilis isolate FELIX_MS22]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P25958

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1