Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   SBO70_RS13400 Genome accession   NZ_CP137890
Coordinates   2727386..2727823 (-) Length   145 a.a.
NCBI ID   WP_015417817.1    Uniprot ID   -
Organism   Bacillus velezensis strain GJJK74     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2722386..2732823
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SBO70_RS13350 (SBO70_13350) sinI 2722770..2722943 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  SBO70_RS13355 (SBO70_13355) sinR 2722977..2723312 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  SBO70_RS13360 (SBO70_13360) tasA 2723360..2724145 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  SBO70_RS13365 (SBO70_13365) sipW 2724210..2724794 (-) 585 WP_015240205.1 signal peptidase I SipW -
  SBO70_RS13370 (SBO70_13370) tapA 2724766..2725437 (-) 672 WP_031378945.1 amyloid fiber anchoring/assembly protein TapA -
  SBO70_RS13375 (SBO70_13375) - 2725696..2726025 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  SBO70_RS13380 (SBO70_13380) - 2726065..2726244 (-) 180 WP_003153093.1 YqzE family protein -
  SBO70_RS13385 (SBO70_13385) comGG 2726301..2726678 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  SBO70_RS13390 (SBO70_13390) comGF 2726679..2727179 (-) 501 WP_257738552.1 competence type IV pilus minor pilin ComGF -
  SBO70_RS13395 (SBO70_13395) comGE 2727088..2727402 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  SBO70_RS13400 (SBO70_13400) comGD 2727386..2727823 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  SBO70_RS13405 (SBO70_13405) comGC 2727813..2728121 (-) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  SBO70_RS13410 (SBO70_13410) comGB 2728126..2729163 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  SBO70_RS13415 (SBO70_13415) comGA 2729150..2730220 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  SBO70_RS13420 (SBO70_13420) - 2730413..2731363 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -
  SBO70_RS13425 (SBO70_13425) - 2731509..2732810 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16226.70 Da        Isoelectric Point: 10.1850

>NTDB_id=901185 SBO70_RS13400 WP_015417817.1 2727386..2727823(-) (comGD) [Bacillus velezensis strain GJJK74]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPACTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=901185 SBO70_RS13400 WP_015417817.1 2727386..2727823(-) (comGD) [Bacillus velezensis strain GJJK74]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGTCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATCCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566