Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | SBO70_RS13350 | Genome accession | NZ_CP137890 |
| Coordinates | 2722770..2722943 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain GJJK74 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2717770..2727943
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SBO70_RS13335 (SBO70_13335) | gcvT | 2718583..2719683 (-) | 1101 | WP_031378949.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SBO70_RS13340 (SBO70_13340) | - | 2720107..2721777 (+) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| SBO70_RS13345 (SBO70_13345) | - | 2721799..2722593 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| SBO70_RS13350 (SBO70_13350) | sinI | 2722770..2722943 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| SBO70_RS13355 (SBO70_13355) | sinR | 2722977..2723312 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| SBO70_RS13360 (SBO70_13360) | tasA | 2723360..2724145 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| SBO70_RS13365 (SBO70_13365) | sipW | 2724210..2724794 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| SBO70_RS13370 (SBO70_13370) | tapA | 2724766..2725437 (-) | 672 | WP_031378945.1 | amyloid fiber anchoring/assembly protein TapA | - |
| SBO70_RS13375 (SBO70_13375) | - | 2725696..2726025 (+) | 330 | WP_039254490.1 | DUF3889 domain-containing protein | - |
| SBO70_RS13380 (SBO70_13380) | - | 2726065..2726244 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| SBO70_RS13385 (SBO70_13385) | comGG | 2726301..2726678 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| SBO70_RS13390 (SBO70_13390) | comGF | 2726679..2727179 (-) | 501 | WP_257738552.1 | competence type IV pilus minor pilin ComGF | - |
| SBO70_RS13395 (SBO70_13395) | comGE | 2727088..2727402 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| SBO70_RS13400 (SBO70_13400) | comGD | 2727386..2727823 (-) | 438 | WP_015417817.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=901182 SBO70_RS13350 WP_003153105.1 2722770..2722943(+) (sinI) [Bacillus velezensis strain GJJK74]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=901182 SBO70_RS13350 WP_003153105.1 2722770..2722943(+) (sinI) [Bacillus velezensis strain GJJK74]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |