Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   SBK94_RS12280 Genome accession   NZ_CP137889
Coordinates   2515783..2516097 (-) Length   104 a.a.
NCBI ID   WP_041481885.1    Uniprot ID   -
Organism   Bacillus velezensis strain N23     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2510783..2521097
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SBK94_RS12235 (SBK94_12235) sinI 2511466..2511639 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  SBK94_RS12240 (SBK94_12240) sinR 2511673..2512008 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  SBK94_RS12245 (SBK94_12245) tasA 2512056..2512841 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  SBK94_RS12250 (SBK94_12250) sipW 2512905..2513489 (-) 585 WP_014305408.1 signal peptidase I SipW -
  SBK94_RS12255 (SBK94_12255) tapA 2513461..2514132 (-) 672 WP_014305409.1 amyloid fiber anchoring/assembly protein TapA -
  SBK94_RS12260 (SBK94_12260) - 2514391..2514720 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  SBK94_RS12265 (SBK94_12265) - 2514760..2514939 (-) 180 WP_003153093.1 YqzE family protein -
  SBK94_RS12270 (SBK94_12270) comGG 2514996..2515373 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  SBK94_RS12275 (SBK94_12275) comGF 2515374..2515874 (-) 501 WP_014305411.1 competence type IV pilus minor pilin ComGF -
  SBK94_RS12280 (SBK94_12280) comGE 2515783..2516097 (-) 315 WP_041481885.1 competence type IV pilus minor pilin ComGE Machinery gene
  SBK94_RS12285 (SBK94_12285) comGD 2516081..2516518 (-) 438 WP_014305413.1 competence type IV pilus minor pilin ComGD Machinery gene
  SBK94_RS12290 (SBK94_12290) comGC 2516508..2516816 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  SBK94_RS12295 (SBK94_12295) comGB 2516821..2517858 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  SBK94_RS12300 (SBK94_12300) comGA 2517845..2518915 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  SBK94_RS12305 (SBK94_12305) - 2519107..2520057 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11830.82 Da        Isoelectric Point: 6.9470

>NTDB_id=901110 SBK94_RS12280 WP_041481885.1 2515783..2516097(-) (comGE) [Bacillus velezensis strain N23]
MLNGNKGFSTIETLSAMAVWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=901110 SBK94_RS12280 WP_041481885.1 2515783..2516097(-) (comGE) [Bacillus velezensis strain N23]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCGTTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481