Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | SBK94_RS12235 | Genome accession | NZ_CP137889 |
| Coordinates | 2511466..2511639 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain N23 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2506466..2516639
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SBK94_RS12220 (SBK94_12220) | gcvT | 2507284..2508384 (-) | 1101 | WP_014305405.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SBK94_RS12225 (SBK94_12225) | - | 2508807..2510477 (+) | 1671 | WP_041481884.1 | DEAD/DEAH box helicase | - |
| SBK94_RS12230 (SBK94_12230) | - | 2510495..2511289 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| SBK94_RS12235 (SBK94_12235) | sinI | 2511466..2511639 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| SBK94_RS12240 (SBK94_12240) | sinR | 2511673..2512008 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| SBK94_RS12245 (SBK94_12245) | tasA | 2512056..2512841 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| SBK94_RS12250 (SBK94_12250) | sipW | 2512905..2513489 (-) | 585 | WP_014305408.1 | signal peptidase I SipW | - |
| SBK94_RS12255 (SBK94_12255) | tapA | 2513461..2514132 (-) | 672 | WP_014305409.1 | amyloid fiber anchoring/assembly protein TapA | - |
| SBK94_RS12260 (SBK94_12260) | - | 2514391..2514720 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| SBK94_RS12265 (SBK94_12265) | - | 2514760..2514939 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| SBK94_RS12270 (SBK94_12270) | comGG | 2514996..2515373 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| SBK94_RS12275 (SBK94_12275) | comGF | 2515374..2515874 (-) | 501 | WP_014305411.1 | competence type IV pilus minor pilin ComGF | - |
| SBK94_RS12280 (SBK94_12280) | comGE | 2515783..2516097 (-) | 315 | WP_041481885.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| SBK94_RS12285 (SBK94_12285) | comGD | 2516081..2516518 (-) | 438 | WP_014305413.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=901107 SBK94_RS12235 WP_003153105.1 2511466..2511639(+) (sinI) [Bacillus velezensis strain N23]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=901107 SBK94_RS12235 WP_003153105.1 2511466..2511639(+) (sinI) [Bacillus velezensis strain N23]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |