Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   SBK94_RS12235 Genome accession   NZ_CP137889
Coordinates   2511466..2511639 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain N23     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2506466..2516639
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SBK94_RS12220 (SBK94_12220) gcvT 2507284..2508384 (-) 1101 WP_014305405.1 glycine cleavage system aminomethyltransferase GcvT -
  SBK94_RS12225 (SBK94_12225) - 2508807..2510477 (+) 1671 WP_041481884.1 DEAD/DEAH box helicase -
  SBK94_RS12230 (SBK94_12230) - 2510495..2511289 (+) 795 WP_014305407.1 YqhG family protein -
  SBK94_RS12235 (SBK94_12235) sinI 2511466..2511639 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  SBK94_RS12240 (SBK94_12240) sinR 2511673..2512008 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  SBK94_RS12245 (SBK94_12245) tasA 2512056..2512841 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  SBK94_RS12250 (SBK94_12250) sipW 2512905..2513489 (-) 585 WP_014305408.1 signal peptidase I SipW -
  SBK94_RS12255 (SBK94_12255) tapA 2513461..2514132 (-) 672 WP_014305409.1 amyloid fiber anchoring/assembly protein TapA -
  SBK94_RS12260 (SBK94_12260) - 2514391..2514720 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  SBK94_RS12265 (SBK94_12265) - 2514760..2514939 (-) 180 WP_003153093.1 YqzE family protein -
  SBK94_RS12270 (SBK94_12270) comGG 2514996..2515373 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  SBK94_RS12275 (SBK94_12275) comGF 2515374..2515874 (-) 501 WP_014305411.1 competence type IV pilus minor pilin ComGF -
  SBK94_RS12280 (SBK94_12280) comGE 2515783..2516097 (-) 315 WP_041481885.1 competence type IV pilus minor pilin ComGE Machinery gene
  SBK94_RS12285 (SBK94_12285) comGD 2516081..2516518 (-) 438 WP_014305413.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=901107 SBK94_RS12235 WP_003153105.1 2511466..2511639(+) (sinI) [Bacillus velezensis strain N23]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=901107 SBK94_RS12235 WP_003153105.1 2511466..2511639(+) (sinI) [Bacillus velezensis strain N23]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702