Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   R6I06_RS17120 Genome accession   NZ_CP137711
Coordinates   3228486..3228626 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate FELIX_MS886     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3223486..3233626
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R6I06_RS17095 (R6I06_17095) yuxO 3223803..3224183 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  R6I06_RS17100 (R6I06_17100) comA 3224202..3224846 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  R6I06_RS17105 (R6I06_17105) comP 3224927..3227233 (-) 2307 Protein_3314 two-component system sensor histidine kinase ComP -
  R6I06_RS17110 (R6I06_17110) comX 3227248..3227415 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  R6I06_RS17115 (R6I06_17115) comQ 3227403..3228301 (-) 899 Protein_3316 ComX modifying isoprenyl transferase ComQ -
  R6I06_RS17120 (R6I06_17120) degQ 3228486..3228626 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  R6I06_RS17125 (R6I06_17125) - 3228848..3228973 (+) 126 WP_003228793.1 hypothetical protein -
  R6I06_RS17130 (R6I06_17130) - 3229087..3229455 (+) 369 WP_003243784.1 hypothetical protein -
  R6I06_RS17135 (R6I06_17135) pdeH 3229431..3230660 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  R6I06_RS17140 (R6I06_17140) pncB 3230797..3232269 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  R6I06_RS17145 (R6I06_17145) pncA 3232285..3232836 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  R6I06_RS17150 (R6I06_17150) yueI 3232933..3233331 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=900146 R6I06_RS17120 WP_003220708.1 3228486..3228626(-) (degQ) [Bacillus subtilis isolate FELIX_MS886]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=900146 R6I06_RS17120 WP_003220708.1 3228486..3228626(-) (degQ) [Bacillus subtilis isolate FELIX_MS886]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1