Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   R6I06_RS17110 Genome accession   NZ_CP137711
Coordinates   3227248..3227415 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis isolate FELIX_MS886     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3222248..3232415
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R6I06_RS17080 (R6I06_17080) mrpE 3222646..3223122 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  R6I06_RS17085 (R6I06_17085) mrpF 3223122..3223406 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  R6I06_RS17090 (R6I06_17090) mnhG 3223390..3223764 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  R6I06_RS17095 (R6I06_17095) yuxO 3223803..3224183 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  R6I06_RS17100 (R6I06_17100) comA 3224202..3224846 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  R6I06_RS17105 (R6I06_17105) comP 3224927..3227233 (-) 2307 Protein_3314 two-component system sensor histidine kinase ComP -
  R6I06_RS17110 (R6I06_17110) comX 3227248..3227415 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  R6I06_RS17115 (R6I06_17115) comQ 3227403..3228301 (-) 899 Protein_3316 ComX modifying isoprenyl transferase ComQ -
  R6I06_RS17120 (R6I06_17120) degQ 3228486..3228626 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  R6I06_RS17125 (R6I06_17125) - 3228848..3228973 (+) 126 WP_003228793.1 hypothetical protein -
  R6I06_RS17130 (R6I06_17130) - 3229087..3229455 (+) 369 WP_003243784.1 hypothetical protein -
  R6I06_RS17135 (R6I06_17135) pdeH 3229431..3230660 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  R6I06_RS17140 (R6I06_17140) pncB 3230797..3232269 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=900145 R6I06_RS17110 WP_003242801.1 3227248..3227415(-) (comX) [Bacillus subtilis isolate FELIX_MS886]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=900145 R6I06_RS17110 WP_003242801.1 3227248..3227415(-) (comX) [Bacillus subtilis isolate FELIX_MS886]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1