Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   R6U80_RS11890 Genome accession   NZ_CP137623
Coordinates   2385769..2386053 (-) Length   94 a.a.
NCBI ID   WP_025017139.1    Uniprot ID   -
Organism   Lactococcus lactis strain NCK401     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2380769..2391053
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R6U80_RS11860 (R6U80_11860) - 2381209..2381586 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  R6U80_RS11865 (R6U80_11865) - 2381791..2382657 (+) 867 WP_025017140.1 RluA family pseudouridine synthase -
  R6U80_RS11870 (R6U80_11870) - 2382695..2383504 (-) 810 WP_014570791.1 metal ABC transporter permease -
  R6U80_RS11875 (R6U80_11875) - 2383497..2384234 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  R6U80_RS11880 (R6U80_11880) - 2384411..2385253 (-) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  R6U80_RS11885 (R6U80_11885) - 2385250..2385687 (-) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  R6U80_RS11890 (R6U80_11890) comGG 2385769..2386053 (-) 285 WP_025017139.1 competence type IV pilus minor pilin ComGG Machinery gene
  R6U80_RS11895 (R6U80_11895) comGF 2386092..2386538 (-) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  R6U80_RS11900 (R6U80_11900) comGE 2386501..2386797 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  R6U80_RS11905 (R6U80_11905) comGD 2386769..2387167 (-) 399 WP_230315852.1 competence type IV pilus minor pilin ComGD Machinery gene
  R6U80_RS11910 (R6U80_11910) comGC 2387160..2387543 (-) 384 WP_313791889.1 competence type IV pilus major pilin ComGC Machinery gene
  R6U80_RS11915 (R6U80_11915) comGB 2387557..2388630 (-) 1074 WP_081041295.1 competence type IV pilus assembly protein ComGB Machinery gene
  R6U80_RS11920 (R6U80_11920) comGA 2388524..2389462 (-) 939 WP_031561106.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10813.05 Da        Isoelectric Point: 5.0604

>NTDB_id=899417 R6U80_RS11890 WP_025017139.1 2385769..2386053(-) (comGG) [Lactococcus lactis strain NCK401]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGTNFQIKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=899417 R6U80_RS11890 WP_025017139.1 2385769..2386053(-) (comGG) [Lactococcus lactis strain NCK401]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGGGATT
TGTCCTACAATTTACTGACAGACTCGTCAGCTAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCACAAACTTTCAAATAAAAAAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.511

100

0.585