Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R4705_RS07860 Genome accession   NZ_CP137115
Coordinates   1493182..1493331 (+) Length   49 a.a.
NCBI ID   WP_001808912.1    Uniprot ID   A0A4J1ZTW6
Organism   Streptococcus pneumoniae strain 20614-6     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1488182..1498331
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R4705_RS07825 blpC 1488493..1488648 (-) 156 WP_000358813.1 quorum-sensing system pheromone BlpC -
  R4705_RS07830 - 1488705..1490066 (-) 1362 WP_001069092.1 bacteriocin secretion accessory protein -
  R4705_RS07835 comA/nlmT 1490077..1490565 (-) 489 WP_307774349.1 ATP-binding cassette domain-containing protein Regulator
  R4705_RS07840 comA/nlmT 1490549..1490989 (-) 441 WP_001808911.1 ATP-binding cassette domain-containing protein Regulator
  R4705_RS07845 comA/nlmT 1490979..1491704 (-) 726 WP_167750760.1 ABC transporter transmembrane domain-containing protein Regulator
  R4705_RS07850 comA/nlmT 1491649..1492236 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  R4705_RS07855 blpI 1492518..1492715 (+) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  R4705_RS07860 cipB 1493182..1493331 (+) 150 WP_001808912.1 bacteriocin-like peptide BlpO Regulator
  R4705_RS07865 - 1493435..1493554 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  R4705_RS07870 - 1494340..1494723 (+) 384 WP_000877381.1 hypothetical protein -
  R4705_RS07875 - 1494775..1495464 (+) 690 WP_000760526.1 CPBP family intramembrane glutamic endopeptidase -
  R4705_RS07880 blpZ 1495506..1495754 (+) 249 WP_000276499.1 immunity protein BlpZ -
  R4705_RS07885 - 1495784..1496395 (+) 612 WP_000394045.1 CPBP family intramembrane glutamic endopeptidase -
  R4705_RS07890 ccrZ 1496556..1497350 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -
  R4705_RS07895 trmB 1497347..1497982 (+) 636 WP_001266080.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5150.86 Da        Isoelectric Point: 3.7098

>NTDB_id=896289 R4705_RS07860 WP_001808912.1 1493182..1493331(+) (cipB) [Streptococcus pneumoniae strain 20614-6]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=896289 R4705_RS07860 WP_001808912.1 1493182..1493331(+) (cipB) [Streptococcus pneumoniae strain 20614-6]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A4J1ZTW6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51