Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R4702_RS02665 Genome accession   NZ_CP137106
Coordinates   535547..535696 (-) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 16P4028     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 530547..540696
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R4702_RS02630 - 531223..531834 (-) 612 WP_000394042.1 CPBP family intramembrane glutamic endopeptidase -
  R4702_RS02635 blpZ 531864..532112 (-) 249 WP_000276506.1 immunity protein BlpZ -
  R4702_RS02640 - 532154..532843 (-) 690 WP_033705505.1 CPBP family intramembrane glutamic endopeptidase -
  R4702_RS02645 - 532875..533108 (-) 234 WP_033705506.1 bacteriocin class II family protein -
  R4702_RS02650 - 533355..534324 (-) 970 Protein_528 thioredoxin domain-containing protein -
  R4702_RS02655 - 534485..534856 (-) 372 WP_033705507.1 hypothetical protein -
  R4702_RS02660 - 535324..535443 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  R4702_RS10965 - 535446..535511 (-) 66 Protein_531 ComC/BlpC family peptide pheromone/bacteriocin -
  R4702_RS02665 cipB 535547..535696 (-) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  R4702_RS02670 blpN 535940..536143 (-) 204 WP_001099490.1 two-peptide bacteriocin subunit BlpN -
  R4702_RS02675 blpM 536159..536413 (-) 255 WP_317810210.1 two-peptide bacteriocin subunit BlpM -
  R4702_RS02680 comA/nlmT 536731..537318 (+) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  R4702_RS02685 comA/nlmT 537245..538888 (+) 1644 WP_078138292.1 peptide cleavage/export ABC transporter Regulator
  R4702_RS02690 - 538899..540260 (+) 1362 WP_024478409.1 bacteriocin secretion accessory protein -
  R4702_RS02695 blpC 540317..540472 (+) 156 WP_000358817.1 quorum-sensing system pheromone BlpC -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=895535 R4702_RS02665 WP_001809846.1 535547..535696(-) (cipB) [Streptococcus pneumoniae strain 16P4028]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=895535 R4702_RS02665 WP_001809846.1 535547..535696(-) (cipB) [Streptococcus pneumoniae strain 16P4028]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531