NTDB

Overview

Name	ssbA	Type	Machinery gene
Locus tag	R4708_RS09530	Genome accession	NZ_CP137104
Coordinates	1825691..1826161 (+)	Length	156 a.a.
NCBI ID	WP_000609607.1	Uniprot ID	-
Organism	Streptococcus pneumoniae strain LM
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 1820691..1831161

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
R4708_RS09500	-	1820975..1821523 (-)	549	WP_000039614.1	NADPH-dependent FMN reductase	-
R4708_RS09505	-	1821844..1822332 (+)	489	WP_000747253.1	DUF5590 domain-containing protein	-
R4708_RS09510	-	1822329..1823516 (+)	1188	WP_000777792.1	pyridoxal phosphate-dependent aminotransferase	-
R4708_RS09515	-	1823509..1823874 (+)	366	Protein_1836	VOC family protein	-
R4708_RS09520	asnS	1823893..1825236 (+)	1344	WP_000167151.1	asparagine--tRNA ligase	-
R4708_RS09525	rpsF	1825389..1825679 (+)	291	WP_001151785.1	30S ribosomal protein S6	-
R4708_RS09530	ssbA	1825691..1826161 (+)	471	WP_000609607.1	single-stranded DNA-binding protein SsbA	Machinery gene
R4708_RS09535	rpsR	1826193..1826432 (+)	240	WP_000068664.1	30S ribosomal protein S18	-
R4708_RS09540	-	1826727..1828127 (+)	1401	WP_000339034.1	bifunctional Cof-type HAD-IIB family hydrolase/peptidylprolyl isomerase	-
R4708_RS09545	-	1828129..1828488 (+)	360	WP_000689600.1	S1 RNA-binding domain-containing protein	-
R4708_RS09550	-	1828542..1829291 (+)	750	WP_000390781.1	tRNA1(Val) (adenine(37)-N6)-methyltransferase	-
R4708_RS09555	-	1829281..1829580 (+)	300	WP_000349602.1	GIY-YIG nuclease family protein	-
R4708_RS09560	-	1829651..1830586 (+)	936	WP_000036043.1	manganese-dependent inorganic pyrophosphatase	-

Sequence

Protein

Download Length: 156 a.a. Molecular weight: 17351.21 Da Isoelectric Point: 5.2065

                                >NTDB_id=895439 R4708_RS09530 WP_000609607.1 1825691..1826161(+) (ssbA) [Streptococcus pneumoniae strain LM]

MINNVVLVGRMTRDAELRYTPSNVAVATFTLAVNRTFKSQNGEREADFINVVMWRQQAENLANWAKKGSLIGVTGRIQTR

SYDNQQGQRVYVTEVVAENFQMLESRSVREGHTGGAYSAPTANYSAPTNSVPDFSRNENPFGATNPLDISDDDLPF

Nucleotide

Download Length: 471 bp

                                >NTDB_id=895439 R4708_RS09530 WP_000609607.1 1825691..1826161(+) (ssbA) [Streptococcus pneumoniae strain LM]

ATGATTAACAATGTTGTACTTGTAGGGCGTATGACACGTGACGCTGAGTTGCGTTATACCCCATCAAATGTAGCAGTTGC

GACTTTTACTCTTGCAGTAAACCGTACATTTAAGAGTCAAAATGGTGAACGTGAGGCTGATTTTATCAATGTCGTTATGT

GGCGCCAACAGGCTGAAAATCTTGCTAACTGGGCTAAAAAAGGCTCACTTATCGGGGTGACAGGTCGTATCCAGACTCGT

AGTTACGATAACCAGCAAGGACAACGTGTCTACGTGACAGAGGTCGTGGCTGAGAATTTCCAAATGTTGGAAAGCCGTAG

TGTGCGTGAGGGTCACACAGGTGGAGCTTACTCTGCACCAACTGCAAACTATTCAGCACCTACAAATTCAGTACCAGACT

TTTCACGTAATGAAAATCCATTTGGAGCAACAAACCCATTGGATATTTCAGATGATGATTTACCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	55.814	100	0.615
ssb	Latilactobacillus sakei subsp. sakei 23K	54.118	100	0.59
ssbB	Bacillus subtilis subsp. subtilis str. 168	55.66	67.949	0.378
ssbB	Streptococcus sobrinus strain NIDR 6715-7	54.128	69.872	0.378
ssbB/cilA	Streptococcus pneumoniae TIGR4	53.211	69.872	0.372
ssbB/cilA	Streptococcus mitis SK321	52.294	69.872	0.365
ssbB/cilA	Streptococcus mitis NCTC 12261	52.294	69.872	0.365
ssbB/cilA	Streptococcus pneumoniae Rx1	52.294	69.872	0.365
ssbB/cilA	Streptococcus pneumoniae D39	52.294	69.872	0.365
ssbB/cilA	Streptococcus pneumoniae R6	52.294	69.872	0.365

Detailed information NTG0895439