Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R4710_RS08420 Genome accession   NZ_CP137101
Coordinates   1595899..1596048 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 16P2012-2     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1590899..1601048
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R4710_RS08390 blpC 1591151..1591306 (-) 156 WP_000358811.1 quorum-sensing system pheromone BlpC -
  R4710_RS08395 - 1591363..1592724 (-) 1362 WP_001069064.1 bacteriocin secretion accessory protein -
  R4710_RS08400 comA/nlmT 1592735..1594411 (-) 1677 WP_306423909.1 peptide cleavage/export ABC transporter Regulator
  R4710_RS08405 comA/nlmT 1594305..1594892 (-) 588 WP_050245347.1 cysteine peptidase family C39 domain-containing protein Regulator
  R4710_RS08410 blpM 1595182..1595436 (+) 255 WP_050245346.1 two-peptide bacteriocin subunit BlpM -
  R4710_RS08415 blpN 1595452..1595655 (+) 204 WP_001099490.1 two-peptide bacteriocin subunit BlpN -
  R4710_RS08420 cipB 1595899..1596048 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  R4710_RS11280 - 1596084..1596149 (+) 66 Protein_1621 ComC/BlpC family peptide pheromone/bacteriocin -
  R4710_RS08425 - 1596152..1596271 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  R4710_RS08430 - 1596739..1597110 (+) 372 WP_404969402.1 hypothetical protein -
  R4710_RS08435 - 1597271..1598240 (+) 970 Protein_1624 thioredoxin domain-containing protein -
  R4710_RS08440 - 1598487..1598720 (+) 234 WP_033705506.1 bacteriocin class II family protein -
  R4710_RS08445 - 1598752..1599441 (+) 690 WP_033705505.1 CPBP family intramembrane glutamic endopeptidase -
  R4710_RS08450 blpZ 1599483..1599731 (+) 249 WP_000276506.1 immunity protein BlpZ -
  R4710_RS08455 - 1599761..1600372 (+) 612 WP_000394042.1 CPBP family intramembrane glutamic endopeptidase -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=895210 R4710_RS08420 WP_001809846.1 1595899..1596048(+) (cipB) [Streptococcus pneumoniae strain 16P2012-2]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=895210 R4710_RS08420 WP_001809846.1 1595899..1596048(+) (cipB) [Streptococcus pneumoniae strain 16P2012-2]
ATGAATACAAAAATGATGTCTCAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531