Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AAVC70_RS06175 Genome accession   NZ_CP154898
Coordinates   1001139..1001279 (-) Length   46 a.a.
NCBI ID   WP_013353398.1    Uniprot ID   P06532
Organism   Bacillus amyloliquefaciens strain Fad 97     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 996139..1006279
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVC70_RS06150 (AAVC70_06150) - 996220..998232 (-) 2013 Protein_1085 histidine kinase -
  AAVC70_RS06160 (AAVC70_06160) comP 999592..999894 (-) 303 WP_345816382.1 hypothetical protein Regulator
  AAVC70_RS06165 (AAVC70_06165) comX 999917..1000093 (-) 177 WP_013353396.1 competence pheromone ComX -
  AAVC70_RS06170 (AAVC70_06170) comQ 1000112..1000987 (-) 876 WP_013353397.1 polyprenyl synthetase family protein Regulator
  AAVC70_RS06175 (AAVC70_06175) degQ 1001139..1001279 (-) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  AAVC70_RS06180 (AAVC70_06180) - 1001744..1002085 (+) 342 WP_013353399.1 hypothetical protein -
  AAVC70_RS06185 (AAVC70_06185) - 1002092..1003315 (-) 1224 WP_013353400.1 EAL and HDOD domain-containing protein -
  AAVC70_RS06190 (AAVC70_06190) - 1003445..1004911 (-) 1467 WP_014472199.1 nicotinate phosphoribosyltransferase -
  AAVC70_RS06195 (AAVC70_06195) - 1004929..1005480 (-) 552 WP_013353402.1 isochorismatase family cysteine hydrolase -
  AAVC70_RS06200 (AAVC70_06200) - 1005561..1005956 (-) 396 WP_013353403.1 DUF1694 domain-containing protein -
  AAVC70_RS06205 (AAVC70_06205) - 1006022..1006270 (-) 249 WP_013353404.1 YueH family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5532.37 Da        Isoelectric Point: 6.2567

>NTDB_id=894657 AAVC70_RS06175 WP_013353398.1 1001139..1001279(-) (degQ) [Bacillus amyloliquefaciens strain Fad 97]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=894657 AAVC70_RS06175 WP_013353398.1 1001139..1001279(-) (degQ) [Bacillus amyloliquefaciens strain Fad 97]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P06532

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

91.304

100

0.913