Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   R3Y73_RS05580 Genome accession   NZ_CP137015
Coordinates   1134641..1134781 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain CYS06     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1129641..1139781
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R3Y73_RS05555 (R3Y73_05555) - 1129968..1130351 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  R3Y73_RS05560 (R3Y73_05560) comA 1130373..1131017 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  R3Y73_RS05565 (R3Y73_05565) comP 1131098..1133404 (-) 2307 WP_165409405.1 sensor histidine kinase Regulator
  R3Y73_RS05570 (R3Y73_05570) comX 1133423..1133599 (-) 177 WP_044052947.1 competence pheromone ComX -
  R3Y73_RS05575 (R3Y73_05575) - 1133614..1134489 (-) 876 WP_146277410.1 polyprenyl synthetase family protein -
  R3Y73_RS05580 (R3Y73_05580) degQ 1134641..1134781 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  R3Y73_RS05585 (R3Y73_05585) - 1135246..1135587 (+) 342 WP_014305721.1 hypothetical protein -
  R3Y73_RS05590 (R3Y73_05590) - 1135594..1136814 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  R3Y73_RS05595 (R3Y73_05595) - 1136944..1138410 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  R3Y73_RS05600 (R3Y73_05600) - 1138428..1138979 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  R3Y73_RS05605 (R3Y73_05605) - 1139076..1139474 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=894334 R3Y73_RS05580 WP_003152043.1 1134641..1134781(-) (degQ) [Bacillus velezensis strain CYS06]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=894334 R3Y73_RS05580 WP_003152043.1 1134641..1134781(-) (degQ) [Bacillus velezensis strain CYS06]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891