Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   RAS18_RS12430 Genome accession   NZ_CP136635
Coordinates   2501192..2501566 (-) Length   124 a.a.
NCBI ID   WP_106044150.1    Uniprot ID   -
Organism   Bacillus atrophaeus subsp. globigii strain Hab-5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2496192..2506566
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RAS18_RS12390 - 2496491..2497285 (+) 795 WP_242556974.1 YqhG family protein -
  RAS18_RS12395 sinI 2497475..2497648 (+) 174 WP_061572833.1 anti-repressor SinI Regulator
  RAS18_RS12400 sinR 2497682..2498017 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RAS18_RS12405 tasA 2498208..2498990 (-) 783 WP_061572832.1 biofilm matrix protein TasA -
  RAS18_RS12410 sipW 2499054..2499626 (-) 573 WP_010789195.1 signal peptidase I SipW -
  RAS18_RS12415 tapA 2499610..2500311 (-) 702 WP_406620639.1 amyloid fiber anchoring/assembly protein TapA -
  RAS18_RS12420 - 2500573..2500896 (+) 324 WP_106044151.1 DUF3889 domain-containing protein -
  RAS18_RS12425 - 2500943..2501122 (-) 180 WP_061572829.1 YqzE family protein -
  RAS18_RS12430 comGG 2501192..2501566 (-) 375 WP_106044150.1 competence type IV pilus minor pilin ComGG Machinery gene
  RAS18_RS12435 comGF 2501567..2501962 (-) 396 WP_406622006.1 competence type IV pilus minor pilin ComGF Machinery gene
  RAS18_RS12440 comGE 2501976..2502323 (-) 348 WP_106044149.1 competence type IV pilus minor pilin ComGE Machinery gene
  RAS18_RS12445 comGD 2502307..2502747 (-) 441 WP_106044148.1 competence type IV pilus minor pilin ComGD Machinery gene
  RAS18_RS12450 comGC 2502737..2503036 (-) 300 WP_275592182.1 competence type IV pilus major pilin ComGC Machinery gene
  RAS18_RS12455 comGB 2503051..2504088 (-) 1038 WP_106044146.1 competence type IV pilus assembly protein ComGB Machinery gene
  RAS18_RS12460 comGA 2504075..2505145 (-) 1071 WP_106044145.1 competence type IV pilus ATPase ComGA Machinery gene
  RAS18_RS12465 - 2505544..2506497 (-) 954 WP_061572822.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14371.55 Da        Isoelectric Point: 10.0972

>NTDB_id=892037 RAS18_RS12430 WP_106044150.1 2501192..2501566(-) (comGG) [Bacillus atrophaeus subsp. globigii strain Hab-5]
MSRSKGFIYPAVLFAAAVILLVVGYTSSEYITRKTFEKETKEFYIRENLLQNGALLSIRHMLEARQGQKGSRQFEYGLVS
YHIQSTSKKEQKEINVKSVTNSGTEMTARFIFDLKQKKVIHWEE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=892037 RAS18_RS12430 WP_106044150.1 2501192..2501566(-) (comGG) [Bacillus atrophaeus subsp. globigii strain Hab-5]
ATGTCACGGTCGAAAGGCTTTATTTATCCTGCTGTACTTTTTGCAGCAGCTGTTATTTTGCTCGTTGTCGGTTATACATC
GTCAGAATATATCACCCGTAAAACATTTGAAAAGGAAACCAAAGAATTTTACATCAGGGAAAATTTACTGCAAAATGGCG
CACTTCTATCCATTCGTCATATGCTTGAGGCCCGTCAAGGACAAAAAGGCTCACGGCAATTTGAGTATGGGCTGGTGTCT
TATCATATTCAAAGCACATCAAAAAAAGAGCAAAAAGAGATCAATGTAAAATCTGTCACGAATTCAGGCACGGAAATGAC
CGCCCGGTTCATATTTGATTTGAAGCAAAAAAAAGTTATTCATTGGGAAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

62.903

100

0.629