Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   RAS18_RS12395 Genome accession   NZ_CP136635
Coordinates   2497475..2497648 (+) Length   57 a.a.
NCBI ID   WP_061572833.1    Uniprot ID   -
Organism   Bacillus atrophaeus subsp. globigii strain Hab-5     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2492475..2502648
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RAS18_RS12380 gcvT 2493245..2494339 (-) 1095 WP_406620637.1 glycine cleavage system aminomethyltransferase GcvT -
  RAS18_RS12385 - 2494800..2496470 (+) 1671 WP_406620638.1 DEAD/DEAH box helicase -
  RAS18_RS12390 - 2496491..2497285 (+) 795 WP_242556974.1 YqhG family protein -
  RAS18_RS12395 sinI 2497475..2497648 (+) 174 WP_061572833.1 anti-repressor SinI Regulator
  RAS18_RS12400 sinR 2497682..2498017 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RAS18_RS12405 tasA 2498208..2498990 (-) 783 WP_061572832.1 biofilm matrix protein TasA -
  RAS18_RS12410 sipW 2499054..2499626 (-) 573 WP_010789195.1 signal peptidase I SipW -
  RAS18_RS12415 tapA 2499610..2500311 (-) 702 WP_406620639.1 amyloid fiber anchoring/assembly protein TapA -
  RAS18_RS12420 - 2500573..2500896 (+) 324 WP_106044151.1 DUF3889 domain-containing protein -
  RAS18_RS12425 - 2500943..2501122 (-) 180 WP_061572829.1 YqzE family protein -
  RAS18_RS12430 comGG 2501192..2501566 (-) 375 WP_106044150.1 competence type IV pilus minor pilin ComGG Machinery gene
  RAS18_RS12435 comGF 2501567..2501962 (-) 396 WP_406622006.1 competence type IV pilus minor pilin ComGF Machinery gene
  RAS18_RS12440 comGE 2501976..2502323 (-) 348 WP_106044149.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6783.88 Da        Isoelectric Point: 10.4757

>NTDB_id=892035 RAS18_RS12395 WP_061572833.1 2497475..2497648(+) (sinI) [Bacillus atrophaeus subsp. globigii strain Hab-5]
MKNAKKELLELDQEWVELMKRAREANINPEEIRKYLNLHKKSARPVPATRSHTINPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=892035 RAS18_RS12395 WP_061572833.1 2497475..2497648(+) (sinI) [Bacillus atrophaeus subsp. globigii strain Hab-5]
ATGAAAAATGCAAAAAAAGAGCTTTTAGAATTAGATCAAGAATGGGTTGAATTAATGAAAAGAGCCAGAGAAGCAAATAT
CAACCCGGAGGAGATACGCAAATATTTAAATTTGCATAAAAAGTCTGCTCGTCCTGTCCCAGCCACCAGAAGTCATACCA
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

77.193

100

0.772