Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   RAS18_RS02200 Genome accession   NZ_CP136635
Coordinates   446182..446301 (+) Length   39 a.a.
NCBI ID   WP_004430266.1    Uniprot ID   -
Organism   Bacillus atrophaeus subsp. globigii strain Hab-5     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 441182..451301
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RAS18_RS02180 - 441296..442447 (+) 1152 WP_406621338.1 M20 peptidase aminoacylase family protein -
  RAS18_RS02185 - 442444..443790 (+) 1347 WP_406621339.1 MmgE/PrpD family protein -
  RAS18_RS02190 - 443907..444822 (+) 916 Protein_398 IS3 family transposase -
  RAS18_RS02195 rapC 445050..446198 (+) 1149 WP_406621340.1 tetratricopeptide repeat protein Regulator
  RAS18_RS02200 phrC 446182..446301 (+) 120 WP_004430266.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  RAS18_RS02205 - 446435..446542 (-) 108 WP_082786775.1 YjcZ family sporulation protein -
  RAS18_RS02210 - 446649..448013 (-) 1365 WP_406621342.1 aspartate kinase -
  RAS18_RS02215 ceuB 448445..449395 (+) 951 WP_061572374.1 ABC transporter permease Machinery gene
  RAS18_RS02220 - 449388..450335 (+) 948 WP_010789704.1 iron chelate uptake ABC transporter family permease subunit -
  RAS18_RS02225 - 450329..451087 (+) 759 WP_406621343.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4111.89 Da        Isoelectric Point: 7.9858

>NTDB_id=892004 RAS18_RS02200 WP_004430266.1 446182..446301(+) (phrC) [Bacillus atrophaeus subsp. globigii strain Hab-5]
MKLKSKLLIICLAAAAVFATVGVSNAEAPDYQVTERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=892004 RAS18_RS02200 WP_004430266.1 446182..446301(+) (phrC) [Bacillus atrophaeus subsp. globigii strain Hab-5]
ATGAAATTGAAATCTAAATTGCTCATTATTTGTTTGGCTGCAGCTGCTGTGTTTGCAACAGTTGGAGTGTCCAATGCTGA
AGCGCCTGATTATCAGGTGACAGAAAGAGGAATGACGTAA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

75

100

0.769