Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   RYX39_RS16205 Genome accession   NZ_CP136430
Coordinates   3142824..3142964 (-) Length   46 a.a.
NCBI ID   WP_024122683.1    Uniprot ID   A0A9Q4HP57
Organism   Bacillus halotolerans strain Q2H2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3137824..3147964
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RYX39_RS16180 (RYX39_16180) - 3138175..3138555 (-) 381 WP_044158943.1 hotdog fold thioesterase -
  RYX39_RS16185 (RYX39_16185) comA 3138573..3139217 (-) 645 WP_168748642.1 two-component system response regulator ComA Regulator
  RYX39_RS16190 (RYX39_16190) comP 3139298..3141595 (-) 2298 WP_255001792.1 histidine kinase Regulator
  RYX39_RS16195 (RYX39_16195) comX 3141603..3141764 (-) 162 WP_255001794.1 competence pheromone ComX -
  RYX39_RS16200 (RYX39_16200) - 3141779..3142639 (-) 861 WP_255001796.1 polyprenyl synthetase family protein -
  RYX39_RS16205 (RYX39_16205) degQ 3142824..3142964 (-) 141 WP_024122683.1 degradation enzyme regulation protein DegQ Regulator
  RYX39_RS16210 (RYX39_16210) - 3143425..3143793 (+) 369 WP_106019478.1 hypothetical protein -
  RYX39_RS16215 (RYX39_16215) - 3143769..3144998 (-) 1230 WP_255001801.1 EAL and HDOD domain-containing protein -
  RYX39_RS16220 (RYX39_16220) - 3145134..3146603 (-) 1470 WP_024122686.1 nicotinate phosphoribosyltransferase -
  RYX39_RS16225 (RYX39_16225) - 3146619..3147170 (-) 552 WP_106019480.1 cysteine hydrolase family protein -
  RYX39_RS16230 (RYX39_16230) - 3147267..3147665 (-) 399 WP_106019481.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5533.44 Da        Isoelectric Point: 6.2559

>NTDB_id=891057 RYX39_RS16205 WP_024122683.1 3142824..3142964(-) (degQ) [Bacillus halotolerans strain Q2H2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=891057 RYX39_RS16205 WP_024122683.1 3142824..3142964(-) (degQ) [Bacillus halotolerans strain Q2H2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

97.826

100

0.978