Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   RX140_RS09920 Genome accession   NZ_CP136358
Coordinates   2036124..2036651 (-) Length   175 a.a.
NCBI ID   WP_021732903.1    Uniprot ID   -
Organism   Enterococcus faecalis strain ES-2953     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2003546..2044867 2036124..2036651 within 0


Gene organization within MGE regions


Location: 2003546..2044867
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RX140_RS09685 (RX140_09685) - 2003546..2004121 (+) 576 WP_010818758.1 SHOCT domain-containing protein -
  RX140_RS09690 (RX140_09690) - 2004386..2004871 (-) 486 WP_002406111.1 hypothetical protein -
  RX140_RS09700 (RX140_09700) - 2005108..2005497 (-) 390 WP_002410143.1 MAG6450 family protein -
  RX140_RS09705 (RX140_09705) - 2005501..2005956 (-) 456 WP_002410142.1 Panacea domain-containing protein -
  RX140_RS09710 (RX140_09710) - 2006213..2007514 (-) 1302 WP_010826293.1 LysM peptidoglycan-binding domain-containing protein -
  RX140_RS09715 (RX140_09715) - 2007511..2007747 (-) 237 WP_010815140.1 phage holin -
  RX140_RS09720 (RX140_09720) - 2007740..2007961 (-) 222 WP_002406118.1 hypothetical protein -
  RX140_RS09725 (RX140_09725) - 2008041..2009063 (-) 1023 WP_048948766.1 pyocin knob domain-containing protein -
  RX140_RS09730 (RX140_09730) - 2009075..2009203 (-) 129 WP_016024399.1 hypothetical protein -
  RX140_RS09735 (RX140_09735) - 2009223..2011640 (-) 2418 WP_002406121.1 gp58-like family protein -
  RX140_RS09740 (RX140_09740) - 2011657..2012022 (-) 366 WP_010815139.1 DUF6711 family protein -
  RX140_RS09745 (RX140_09745) - 2012033..2016568 (-) 4536 WP_010815138.1 transglycosylase SLT domain-containing protein -
  RX140_RS09750 (RX140_09750) - 2016578..2016937 (-) 360 WP_002406125.1 hypothetical protein -
  RX140_RS09755 (RX140_09755) - 2016970..2017380 (-) 411 WP_002406126.1 DUF6096 family protein -
  RX140_RS09760 (RX140_09760) - 2017437..2017895 (-) 459 WP_010815137.1 hypothetical protein -
  RX140_RS09765 (RX140_09765) - 2017915..2018277 (-) 363 WP_002415689.1 hypothetical protein -
  RX140_RS09770 (RX140_09770) - 2018274..2018813 (-) 540 WP_010815136.1 hypothetical protein -
  RX140_RS09775 (RX140_09775) - 2018813..2019154 (-) 342 WP_002406131.1 hypothetical protein -
  RX140_RS09780 (RX140_09780) - 2019135..2019473 (-) 339 WP_002415688.1 phage head-tail connector protein -
  RX140_RS09785 (RX140_09785) - 2019487..2020524 (-) 1038 WP_002406133.1 major capsid protein -
  RX140_RS09790 (RX140_09790) - 2020540..2021190 (-) 651 WP_010815135.1 DUF4355 domain-containing protein -
  RX140_RS09795 (RX140_09795) - 2021351..2022499 (-) 1149 WP_010815134.1 minor capsid protein -
  RX140_RS09800 (RX140_09800) - 2022500..2022811 (-) 312 WP_002406137.1 ribosomal-processing cysteine protease Prp -
  RX140_RS09805 (RX140_09805) - 2022792..2024219 (-) 1428 WP_142428191.1 phage portal protein -
  RX140_RS09810 (RX140_09810) - 2024233..2025537 (-) 1305 WP_174129863.1 PBSX family phage terminase large subunit -
  RX140_RS09815 (RX140_09815) terS 2025509..2026312 (-) 804 WP_174129862.1 phage terminase small subunit -
  RX140_RS09820 (RX140_09820) - 2026359..2026727 (-) 369 WP_053086780.1 hypothetical protein -
  RX140_RS09825 (RX140_09825) - 2026915..2027364 (-) 450 WP_048948707.1 hypothetical protein -
  RX140_RS09835 (RX140_09835) - 2028205..2028621 (-) 417 WP_002357362.1 ArpU family phage packaging/lysis transcriptional regulator -
  RX140_RS09840 (RX140_09840) - 2029044..2029259 (-) 216 WP_316498068.1 hypothetical protein -
  RX140_RS09845 (RX140_09845) - 2029394..2029651 (-) 258 WP_238461539.1 DUF1642 domain-containing protein -
  RX140_RS09850 (RX140_09850) - 2029784..2030101 (-) 318 Protein_1922 DUF1642 domain-containing protein -
  RX140_RS09855 (RX140_09855) - 2030098..2030340 (-) 243 WP_104890161.1 hypothetical protein -
  RX140_RS09860 (RX140_09860) - 2030340..2030672 (-) 333 WP_104890162.1 hypothetical protein -
  RX140_RS09865 (RX140_09865) - 2030665..2031210 (-) 546 WP_142428196.1 DUF1642 domain-containing protein -
  RX140_RS09870 (RX140_09870) - 2031222..2031470 (-) 249 WP_002396632.1 hypothetical protein -
  RX140_RS09875 (RX140_09875) - 2031467..2031838 (-) 372 WP_126267475.1 hypothetical protein -
  RX140_RS09880 (RX140_09880) - 2031835..2032143 (-) 309 WP_048954260.1 hypothetical protein -
  RX140_RS09885 (RX140_09885) - 2032144..2032554 (-) 411 WP_142428195.1 YopX family protein -
  RX140_RS09890 (RX140_09890) - 2032529..2033101 (-) 573 WP_142428194.1 hypothetical protein -
  RX140_RS09895 (RX140_09895) - 2033114..2034058 (-) 945 WP_002380700.1 site-specific integrase -
  RX140_RS09900 (RX140_09900) - 2034055..2034708 (-) 654 WP_142428193.1 N-6 DNA methylase -
  RX140_RS09905 (RX140_09905) - 2034761..2035504 (-) 744 WP_010828985.1 hypothetical protein -
  RX140_RS09910 (RX140_09910) - 2035557..2035763 (-) 207 WP_002395813.1 hypothetical protein -
  RX140_RS09915 (RX140_09915) - 2035783..2036112 (-) 330 WP_015543839.1 hypothetical protein -
  RX140_RS09920 (RX140_09920) ssb 2036124..2036651 (-) 528 WP_021732903.1 single-stranded DNA-binding protein Machinery gene
  RX140_RS09925 (RX140_09925) - 2036641..2036949 (-) 309 WP_010822654.1 MazG-like family protein -
  RX140_RS09930 (RX140_09930) - 2036954..2037805 (-) 852 WP_250869349.1 helix-turn-helix domain-containing protein -
  RX140_RS09935 (RX140_09935) - 2037809..2038450 (-) 642 WP_002414632.1 putative HNHc nuclease -
  RX140_RS09940 (RX140_09940) - 2038455..2039471 (-) 1017 WP_002365157.1 AAA family ATPase -
  RX140_RS09945 (RX140_09945) - 2039483..2039962 (-) 480 WP_002381628.1 siphovirus Gp157 family protein -
  RX140_RS09950 (RX140_09950) - 2039946..2040068 (-) 123 WP_002414628.1 hypothetical protein -
  RX140_RS09955 (RX140_09955) - 2040267..2040440 (-) 174 WP_002414625.1 hypothetical protein -
  RX140_RS09960 (RX140_09960) - 2040452..2040637 (-) 186 WP_002364665.1 hypothetical protein -
  RX140_RS09965 (RX140_09965) - 2040648..2041361 (-) 714 WP_316498069.1 Rha family transcriptional regulator -
  RX140_RS09970 (RX140_09970) - 2041376..2041660 (-) 285 WP_002406299.1 hypothetical protein -
  RX140_RS09975 (RX140_09975) - 2041664..2041864 (-) 201 WP_010818747.1 helix-turn-helix domain-containing protein -
  RX140_RS09980 (RX140_09980) - 2042156..2042545 (+) 390 WP_002403736.1 helix-turn-helix domain-containing protein -
  RX140_RS09985 (RX140_09985) - 2042563..2042991 (+) 429 WP_002406958.1 ImmA/IrrE family metallo-endopeptidase -
  RX140_RS09990 (RX140_09990) - 2043078..2043644 (+) 567 WP_065421246.1 Ltp family lipoprotein -
  RX140_RS09995 (RX140_09995) - 2043713..2044867 (+) 1155 WP_002406960.1 site-specific integrase -

Sequence

Protein


Download         Length: 175 a.a.        Molecular weight: 19369.24 Da        Isoelectric Point: 4.5778

>NTDB_id=890287 RX140_RS09920 WP_021732903.1 2036124..2036651(-) (ssb) [Enterococcus faecalis strain ES-2953]
MINNVVLVGRLTKDPDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYTRKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLEPKSANENRNSIQMSQNDGTSVQNNFEGNYATNQNKGLNQQNNSQQMSFGGDVDPFA
GAGNSIDISDDDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=890287 RX140_RS09920 WP_021732903.1 2036124..2036651(-) (ssb) [Enterococcus faecalis strain ES-2953]
ATGATAAATAATGTGGTATTAGTCGGAAGATTGACAAAAGATCCTGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATACTCGTAAAGGAACATTATTAGGAGTTGTTGGCAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTGTTTGCGAGAGTTTCCAATTATTAGAGCCAAAAAG
CGCCAATGAGAATAGAAATAGCATTCAGATGTCACAGAATGACGGTACAAGCGTTCAAAACAATTTCGAGGGTAATTATG
CCACGAATCAAAACAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATGTCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGTGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCTTTTTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

57.979

100

0.623
  ssbA Bacillus subtilis subsp. subtilis str. 168

58.286

100

0.583
  ssbB Bacillus subtilis subsp. subtilis str. 168

60.377

60.571

0.366