Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   RX793_RS07560 Genome accession   NZ_CP136263
Coordinates   1616182..1616301 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain 0039     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 1611182..1621301
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RX793_RS07535 (RX793_07530) - 1611421..1612179 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  RX793_RS07540 (RX793_07535) - 1612173..1613120 (-) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  RX793_RS07545 (RX793_07540) ceuB 1613110..1614063 (-) 954 WP_003156332.1 ABC transporter permease Machinery gene
  RX793_RS07550 (RX793_07545) - 1614478..1615842 (+) 1365 WP_003156333.1 aspartate kinase -
  RX793_RS07555 (RX793_07550) - 1615922..1616032 (+) 111 WP_369719092.1 YjcZ family sporulation protein -
  RX793_RS07560 (RX793_07555) phrC 1616182..1616301 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  RX793_RS07565 (RX793_07560) rapC 1616285..1617433 (-) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  RX793_RS07570 (RX793_07565) - 1617586..1619019 (-) 1434 WP_161625271.1 sensor histidine kinase -
  RX793_RS07575 (RX793_07570) - 1619006..1619689 (-) 684 WP_024084885.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=889972 RX793_RS07560 WP_003156334.1 1616182..1616301(-) (phrC) [Bacillus velezensis strain 0039]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=889972 RX793_RS07560 WP_003156334.1 1616182..1616301(-) (phrC) [Bacillus velezensis strain 0039]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718