Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   RWA21_RS05095 Genome accession   NZ_CP136114
Coordinates   1058290..1058775 (+) Length   161 a.a.
NCBI ID   WP_005716158.1    Uniprot ID   A0AB33XSR6
Organism   Lacticaseibacillus rhamnosus strain LMG 23327     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1044941..1085869 1058290..1058775 within 0


Gene organization within MGE regions


Location: 1044941..1085869
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RWA21_RS04975 (RWA21_04975) - 1044941..1046125 (-) 1185 WP_005716131.1 tyrosine-type recombinase/integrase -
  RWA21_RS04980 (RWA21_04980) - 1046470..1047471 (-) 1002 WP_049170629.1 hypothetical protein -
  RWA21_RS04985 (RWA21_04985) - 1047582..1047785 (-) 204 WP_005716134.1 hypothetical protein -
  RWA21_RS04990 (RWA21_04990) - 1047809..1048234 (-) 426 WP_015764910.1 pyridoxamine 5'-phosphate oxidase family protein -
  RWA21_RS04995 (RWA21_04995) - 1048620..1048838 (+) 219 WP_016364974.1 hypothetical protein -
  RWA21_RS05000 (RWA21_05000) - 1048839..1049594 (-) 756 WP_003606998.1 hypothetical protein -
  RWA21_RS05005 (RWA21_05005) - 1049701..1050402 (-) 702 WP_005716136.1 DUF3862 domain-containing protein -
  RWA21_RS05010 (RWA21_05010) - 1050462..1050884 (-) 423 WP_032961064.1 ImmA/IrrE family metallo-endopeptidase -
  RWA21_RS05015 (RWA21_05015) - 1050874..1051209 (-) 336 WP_005714743.1 helix-turn-helix domain-containing protein -
  RWA21_RS05020 (RWA21_05020) - 1051346..1051588 (+) 243 WP_005716140.1 helix-turn-helix transcriptional regulator -
  RWA21_RS05025 (RWA21_05025) - 1051585..1051749 (+) 165 WP_005716141.1 hypothetical protein -
  RWA21_RS05030 (RWA21_05030) - 1051925..1052632 (-) 708 WP_005716144.1 hypothetical protein -
  RWA21_RS05035 (RWA21_05035) - 1052629..1052859 (-) 231 WP_100223706.1 helix-turn-helix domain-containing protein -
  RWA21_RS05040 (RWA21_05040) - 1053000..1053206 (+) 207 WP_032954501.1 helix-turn-helix domain-containing protein -
  RWA21_RS05045 (RWA21_05045) - 1053206..1053553 (+) 348 WP_005716147.1 hypothetical protein -
  RWA21_RS05050 (RWA21_05050) - 1053546..1054277 (+) 732 WP_005716152.1 antA/AntB antirepressor family protein -
  RWA21_RS05055 (RWA21_05055) - 1054343..1054891 (+) 549 WP_032954503.1 hypothetical protein -
  RWA21_RS05060 (RWA21_05060) - 1054870..1055100 (+) 231 WP_005711341.1 hypothetical protein -
  RWA21_RS05065 (RWA21_05065) - 1055104..1055232 (+) 129 WP_005711343.1 hypothetical protein -
  RWA21_RS05070 (RWA21_05070) - 1055244..1055462 (+) 219 WP_015764324.1 hypothetical protein -
  RWA21_RS05075 (RWA21_05075) - 1055464..1055634 (+) 171 WP_005716154.1 hypothetical protein -
  RWA21_RS05080 (RWA21_05080) - 1055646..1056521 (+) 876 WP_005716155.1 recombinase RecT -
  RWA21_RS05085 (RWA21_05085) - 1056403..1057305 (+) 903 WP_284143497.1 PD-(D/E)XK nuclease-like domain-containing protein -
  RWA21_RS05090 (RWA21_05090) - 1057321..1058277 (+) 957 WP_005716157.1 DnaD domain-containing protein -
  RWA21_RS05095 (RWA21_05095) ssb 1058290..1058775 (+) 486 WP_005716158.1 single-stranded DNA-binding protein Machinery gene
  RWA21_RS05100 (RWA21_05100) - 1059083..1059298 (+) 216 WP_005711356.1 helix-turn-helix transcriptional regulator -
  RWA21_RS05105 (RWA21_05105) - 1059295..1059744 (+) 450 WP_005716160.1 hypothetical protein -
  RWA21_RS05110 (RWA21_05110) - 1059791..1060045 (+) 255 WP_005716161.1 hypothetical protein -
  RWA21_RS05115 (RWA21_05115) - 1060042..1060437 (+) 396 WP_032954505.1 endodeoxyribonuclease -
  RWA21_RS05120 (RWA21_05120) - 1060421..1060546 (+) 126 WP_005716164.1 hypothetical protein -
  RWA21_RS05125 (RWA21_05125) - 1060543..1060833 (+) 291 WP_005716165.1 hypothetical protein -
  RWA21_RS05130 (RWA21_05130) - 1060826..1061062 (+) 237 WP_032954507.1 hypothetical protein -
  RWA21_RS05135 (RWA21_05135) - 1061046..1061237 (+) 192 WP_032954508.1 hypothetical protein -
  RWA21_RS05140 (RWA21_05140) - 1061306..1061527 (+) 222 WP_005711376.1 helix-turn-helix domain-containing protein -
  RWA21_RS05145 (RWA21_05145) - 1061736..1062164 (+) 429 WP_005711378.1 hypothetical protein -
  RWA21_RS05150 (RWA21_05150) - 1063191..1064339 (+) 1149 WP_005688554.1 GcrA family cell cycle regulator -
  RWA21_RS05155 (RWA21_05155) - 1064332..1064718 (+) 387 WP_032954510.1 hypothetical protein -
  RWA21_RS05160 (RWA21_05160) - 1064755..1065288 (+) 534 WP_005716172.1 terminase small subunit -
  RWA21_RS05165 (RWA21_05165) - 1065266..1066621 (+) 1356 WP_005716173.1 PBSX family phage terminase large subunit -
  RWA21_RS05170 (RWA21_05170) - 1066626..1068053 (+) 1428 WP_005716174.1 phage portal protein -
  RWA21_RS05175 (RWA21_05175) - 1068019..1069005 (+) 987 WP_005716175.1 minor capsid protein -
  RWA21_RS05180 (RWA21_05180) - 1069015..1069242 (+) 228 WP_005716176.1 hypothetical protein -
  RWA21_RS05185 (RWA21_05185) - 1069253..1069576 (+) 324 WP_005716178.1 hypothetical protein -
  RWA21_RS05190 (RWA21_05190) - 1069573..1069854 (+) 282 WP_005716179.1 hypothetical protein -
  RWA21_RS05195 (RWA21_05195) - 1069972..1070613 (+) 642 WP_005716180.1 DUF4355 domain-containing protein -
  RWA21_RS05200 (RWA21_05200) - 1070626..1070940 (+) 315 WP_005716181.1 hypothetical protein -
  RWA21_RS05205 (RWA21_05205) - 1070954..1071973 (+) 1020 WP_005716182.1 major capsid protein -
  RWA21_RS05210 (RWA21_05210) - 1071988..1072239 (+) 252 WP_080600005.1 Ig-like domain-containing protein -
  RWA21_RS05215 (RWA21_05215) - 1072309..1072683 (+) 375 WP_003575585.1 phage head-tail connector protein -
  RWA21_RS05220 (RWA21_05220) - 1072688..1072990 (+) 303 WP_005716184.1 hypothetical protein -
  RWA21_RS05225 (RWA21_05225) - 1072987..1073352 (+) 366 WP_005716186.1 HK97-gp10 family putative phage morphogenesis protein -
  RWA21_RS05230 (RWA21_05230) - 1073353..1073757 (+) 405 WP_005716187.1 DUF3168 domain-containing protein -
  RWA21_RS05235 (RWA21_05235) - 1073769..1074371 (+) 603 WP_005716188.1 phage tail tube protein -
  RWA21_RS05240 (RWA21_05240) - 1074458..1074790 (+) 333 WP_005716189.1 tail assembly chaperone -
  RWA21_RS05245 (RWA21_05245) - 1074895..1075248 (+) 354 WP_005711407.1 hypothetical protein -
  RWA21_RS05250 (RWA21_05250) - 1075241..1078330 (+) 3090 WP_316058831.1 tape measure protein -
  RWA21_RS05255 (RWA21_05255) - 1078331..1080319 (+) 1989 Protein_1007 distal tail protein Dit -
  RWA21_RS05260 (RWA21_05260) - 1080320..1082755 (+) 2436 WP_005716193.1 phage tail protein -
  RWA21_RS05265 (RWA21_05265) - 1082757..1083047 (+) 291 WP_005713395.1 hypothetical protein -
  RWA21_RS05270 (RWA21_05270) - 1083040..1083171 (+) 132 WP_005714777.1 XkdX family protein -
  RWA21_RS05275 (RWA21_05275) - 1083152..1083502 (+) 351 WP_225350104.1 hypothetical protein -
  RWA21_RS05280 (RWA21_05280) - 1083517..1083951 (+) 435 WP_005716196.1 phage holin -
  RWA21_RS05285 (RWA21_05285) - 1083951..1085072 (+) 1122 WP_005716197.1 GH25 family lysozyme -
  RWA21_RS05290 (RWA21_05290) - 1085213..1085869 (+) 657 WP_005716198.1 hypothetical protein -

Sequence


Protein


Download         Length: 161 a.a.        Molecular weight: 17644.37 Da        Isoelectric Point: 7.9701

>NTDB_id=888493 RWA21_RS05095 WP_005716158.1 1058290..1058775(+) (ssb) [Lacticaseibacillus rhamnosus strain LMG 23327]
MLNSVSLTGRLTRDVDLRYTQSGTAAGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFANFTKKGSLVGVEGRIQTR
TYDNAQGQKIFVTEVIVDNFALLESRQASQNNPKSQQTANASATATTNASQTTPNASRANTTDPFANNGQPIDIQDDDLP
F

Nucleotide


Download         Length: 486 bp        

>NTDB_id=888493 RWA21_RS05095 WP_005716158.1 1058290..1058775(+) (ssb) [Lacticaseibacillus rhamnosus strain LMG 23327]
TTGCTAAACAGTGTCTCACTAACAGGCCGGCTGACAAGAGATGTTGACTTGCGTTACACGCAAAGTGGCACGGCGGCAGG
ATCATTCACGCTGGCCGTTGACCGCAAATTCAAGAGCAAAAACGGAGAACGAGAAACTGATTTCGTAAATTGCCAGATTT
GGCGCAAGTCGGCTGAGAACTTTGCAAACTTCACCAAAAAAGGATCCTTGGTTGGTGTGGAAGGCCGTATTCAAACGCGT
ACGTACGATAACGCGCAAGGGCAGAAAATATTCGTGACCGAGGTAATCGTTGATAATTTTGCTTTGCTTGAGTCACGACA
GGCGTCTCAGAACAACCCTAAATCACAGCAAACAGCCAATGCATCAGCAACAGCGACCACAAACGCGAGTCAAACGACTC
CAAATGCTTCACGAGCGAATACCACGGATCCGTTTGCTAATAATGGCCAGCCGATAGACATCCAAGATGATGATTTGCCA
TTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

62.791

100

0.671

  ssbA Bacillus subtilis subsp. subtilis str. 168

49.419

100

0.528

  ssbB Bacillus subtilis subsp. subtilis str. 168

54.717

65.839

0.36