Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | RUL31_RS16445 | Genome accession | NZ_CP135964 |
| Coordinates | 3336982..3337125 (-) | Length | 47 a.a. |
| NCBI ID | WP_003327149.1 | Uniprot ID | - |
| Organism | Bacillus atrophaeus strain CD303 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3331982..3342125
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RUL31_RS16420 (RUL31_16420) | - | 3332333..3332713 (-) | 381 | WP_010789785.1 | hotdog fold thioesterase | - |
| RUL31_RS16425 (RUL31_16425) | comA | 3332731..3333372 (-) | 642 | WP_003327154.1 | response regulator transcription factor | Regulator |
| RUL31_RS16430 (RUL31_16430) | comP | 3333453..3335750 (-) | 2298 | WP_277713830.1 | histidine kinase | Regulator |
| RUL31_RS16435 (RUL31_16435) | comX | 3335761..3335925 (-) | 165 | WP_106046982.1 | competence pheromone ComX | - |
| RUL31_RS16440 (RUL31_16440) | - | 3335938..3336798 (-) | 861 | WP_216412504.1 | polyprenyl synthetase family protein | - |
| RUL31_RS16445 (RUL31_16445) | degQ | 3336982..3337125 (-) | 144 | WP_003327149.1 | degradation enzyme regulation protein DegQ | Regulator |
| RUL31_RS16450 (RUL31_16450) | - | 3337585..3337944 (+) | 360 | WP_315915881.1 | hypothetical protein | - |
| RUL31_RS16455 (RUL31_16455) | - | 3337963..3339195 (-) | 1233 | WP_003327147.1 | EAL and HDOD domain-containing protein | - |
| RUL31_RS16460 (RUL31_16460) | - | 3339333..3340799 (-) | 1467 | WP_106359954.1 | nicotinate phosphoribosyltransferase | - |
| RUL31_RS16465 (RUL31_16465) | - | 3340815..3341366 (-) | 552 | WP_315915882.1 | isochorismatase family cysteine hydrolase | - |
| RUL31_RS16470 (RUL31_16470) | - | 3341474..3341872 (-) | 399 | WP_003327144.1 | YueI family protein | - |
Sequence
Protein
Download Length: 47 a.a. Molecular weight: 5645.61 Da Isoelectric Point: 8.5787
>NTDB_id=887847 RUL31_RS16445 WP_003327149.1 3336982..3337125(-) (degQ) [Bacillus atrophaeus strain CD303]
MEKKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS
MEKKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS
Nucleotide
Download Length: 144 bp
>NTDB_id=887847 RUL31_RS16445 WP_003327149.1 3336982..3337125(-) (degQ) [Bacillus atrophaeus strain CD303]
GTGGAAAAGAAAAAACTTGAAGAAGTGAAACAATTATTATTCCGACTCGAACTTGATATCAAAGAAACGACAGATTCATT
ACGAAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATATGCAATGAAAATTTCGTGA
GTGGAAAAGAAAAAACTTGAAGAAGTGAAACAATTATTATTCCGACTCGAACTTGATATCAAAGAAACGACAGATTCATT
ACGAAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATATGCAATGAAAATTTCGTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
95.455 |
93.617 |
0.894 |