Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   RP314_RS07815 Genome accession   NZ_CP135199
Coordinates   1493101..1493478 (+) Length   125 a.a.
NCBI ID   WP_077722592.1    Uniprot ID   -
Organism   Bacillus velezensis strain CMML21-47     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1488101..1498478
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RP314_RS07780 (RP314_07780) - 1488417..1489367 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  RP314_RS07785 (RP314_07785) comGA 1489559..1490629 (+) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  RP314_RS07790 (RP314_07790) comGB 1490616..1491653 (+) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  RP314_RS07795 (RP314_07795) comGC 1491700..1491966 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  RP314_RS07800 (RP314_07800) comGD 1491956..1492393 (+) 438 WP_077722595.1 competence type IV pilus minor pilin ComGD Machinery gene
  RP314_RS07805 (RP314_07805) comGE 1492377..1492691 (+) 315 WP_077722594.1 competence type IV pilus minor pilin ComGE Machinery gene
  RP314_RS07810 (RP314_07810) comGF 1492600..1493100 (+) 501 WP_232213409.1 competence type IV pilus minor pilin ComGF -
  RP314_RS07815 (RP314_07815) comGG 1493101..1493478 (+) 378 WP_077722592.1 competence type IV pilus minor pilin ComGG Machinery gene
  RP314_RS07820 (RP314_07820) - 1493535..1493714 (+) 180 WP_003153093.1 YqzE family protein -
  RP314_RS07825 (RP314_07825) - 1493754..1494083 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  RP314_RS07830 (RP314_07830) tapA 1494342..1495013 (+) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  RP314_RS07835 (RP314_07835) sipW 1494985..1495569 (+) 585 WP_012117977.1 signal peptidase I SipW -
  RP314_RS07840 (RP314_07840) tasA 1495633..1496418 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  RP314_RS07845 (RP314_07845) sinR 1496466..1496801 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RP314_RS07850 (RP314_07850) sinI 1496835..1497008 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  RP314_RS07855 (RP314_07855) - 1497185..1497979 (-) 795 WP_014305407.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14209.17 Da        Isoelectric Point: 9.4395

>NTDB_id=886205 RP314_RS07815 WP_077722592.1 1493101..1493478(+) (comGG) [Bacillus velezensis strain CMML21-47]
MHKSDGFIYPAILFVSAAVLLVISYTSSDFITRKIFEKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=886205 RP314_RS07815 WP_077722592.1 1493101..1493478(+) (comGG) [Bacillus velezensis strain CMML21-47]
ATGCACAAATCTGACGGTTTTATATATCCCGCGATTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAATATTTGAGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCACATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGCGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504