Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   RP314_RS07850 Genome accession   NZ_CP135199
Coordinates   1496835..1497008 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain CMML21-47     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1491835..1502008
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RP314_RS07800 (RP314_07800) comGD 1491956..1492393 (+) 438 WP_077722595.1 competence type IV pilus minor pilin ComGD Machinery gene
  RP314_RS07805 (RP314_07805) comGE 1492377..1492691 (+) 315 WP_077722594.1 competence type IV pilus minor pilin ComGE Machinery gene
  RP314_RS07810 (RP314_07810) comGF 1492600..1493100 (+) 501 WP_232213409.1 competence type IV pilus minor pilin ComGF -
  RP314_RS07815 (RP314_07815) comGG 1493101..1493478 (+) 378 WP_077722592.1 competence type IV pilus minor pilin ComGG Machinery gene
  RP314_RS07820 (RP314_07820) - 1493535..1493714 (+) 180 WP_003153093.1 YqzE family protein -
  RP314_RS07825 (RP314_07825) - 1493754..1494083 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  RP314_RS07830 (RP314_07830) tapA 1494342..1495013 (+) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  RP314_RS07835 (RP314_07835) sipW 1494985..1495569 (+) 585 WP_012117977.1 signal peptidase I SipW -
  RP314_RS07840 (RP314_07840) tasA 1495633..1496418 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  RP314_RS07845 (RP314_07845) sinR 1496466..1496801 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RP314_RS07850 (RP314_07850) sinI 1496835..1497008 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  RP314_RS07855 (RP314_07855) - 1497185..1497979 (-) 795 WP_014305407.1 YqhG family protein -
  RP314_RS07860 (RP314_07860) - 1497997..1499667 (-) 1671 WP_046559872.1 DEAD/DEAH box helicase -
  RP314_RS07865 (RP314_07865) gcvT 1500091..1501191 (+) 1101 WP_077722591.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=886207 RP314_RS07850 WP_003153105.1 1496835..1497008(-) (sinI) [Bacillus velezensis strain CMML21-47]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=886207 RP314_RS07850 WP_003153105.1 1496835..1497008(-) (sinI) [Bacillus velezensis strain CMML21-47]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702