Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   RJD11_RS13670 Genome accession   NZ_CP135184
Coordinates   2713391..2713828 (-) Length   145 a.a.
NCBI ID   WP_015240210.1    Uniprot ID   -
Organism   Bacillus velezensis strain NDB     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2708391..2718828
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RJD11_RS13620 (RJD11_13620) sinI 2708775..2708948 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  RJD11_RS13625 (RJD11_13625) sinR 2708982..2709317 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RJD11_RS13630 (RJD11_13630) tasA 2709365..2710150 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  RJD11_RS13635 (RJD11_13635) sipW 2710215..2710799 (-) 585 WP_015240205.1 signal peptidase I SipW -
  RJD11_RS13640 (RJD11_13640) tapA 2710771..2711442 (-) 672 WP_124692843.1 amyloid fiber anchoring/assembly protein TapA -
  RJD11_RS13645 (RJD11_13645) - 2711701..2712030 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  RJD11_RS13650 (RJD11_13650) - 2712070..2712249 (-) 180 WP_003153093.1 YqzE family protein -
  RJD11_RS13655 (RJD11_13655) comGG 2712306..2712683 (-) 378 WP_015240208.1 competence type IV pilus minor pilin ComGG Machinery gene
  RJD11_RS13660 (RJD11_13660) comGF 2712684..2713184 (-) 501 WP_256994853.1 competence type IV pilus minor pilin ComGF -
  RJD11_RS13665 (RJD11_13665) comGE 2713093..2713407 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  RJD11_RS13670 (RJD11_13670) comGD 2713391..2713828 (-) 438 WP_015240210.1 competence type IV pilus minor pilin ComGD Machinery gene
  RJD11_RS13675 (RJD11_13675) comGC 2713818..2714126 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  RJD11_RS13680 (RJD11_13680) comGB 2714131..2715168 (-) 1038 WP_218791295.1 competence type IV pilus assembly protein ComGB Machinery gene
  RJD11_RS13685 (RJD11_13685) comGA 2715155..2716225 (-) 1071 WP_124692840.1 competence type IV pilus ATPase ComGA Machinery gene
  RJD11_RS13690 (RJD11_13690) - 2716418..2717368 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  RJD11_RS13695 (RJD11_13695) - 2717514..2718815 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16272.75 Da        Isoelectric Point: 10.2186

>NTDB_id=886046 RJD11_RS13670 WP_015240210.1 2713391..2713828(-) (comGD) [Bacillus velezensis strain NDB]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGKILERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=886046 RJD11_RS13670 WP_015240210.1 2713391..2713828(-) (comGD) [Bacillus velezensis strain NDB]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAGCAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAAGATTCTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTTCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572