Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | RJD11_RS13620 | Genome accession | NZ_CP135184 |
| Coordinates | 2708775..2708948 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain NDB | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2703775..2713948
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RJD11_RS13605 (RJD11_13605) | gcvT | 2704588..2705688 (-) | 1101 | WP_025284994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| RJD11_RS13610 (RJD11_13610) | - | 2706112..2707782 (+) | 1671 | WP_132105375.1 | DEAD/DEAH box helicase | - |
| RJD11_RS13615 (RJD11_13615) | - | 2707804..2708598 (+) | 795 | WP_208480294.1 | YqhG family protein | - |
| RJD11_RS13620 (RJD11_13620) | sinI | 2708775..2708948 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| RJD11_RS13625 (RJD11_13625) | sinR | 2708982..2709317 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| RJD11_RS13630 (RJD11_13630) | tasA | 2709365..2710150 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| RJD11_RS13635 (RJD11_13635) | sipW | 2710215..2710799 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| RJD11_RS13640 (RJD11_13640) | tapA | 2710771..2711442 (-) | 672 | WP_124692843.1 | amyloid fiber anchoring/assembly protein TapA | - |
| RJD11_RS13645 (RJD11_13645) | - | 2711701..2712030 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| RJD11_RS13650 (RJD11_13650) | - | 2712070..2712249 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| RJD11_RS13655 (RJD11_13655) | comGG | 2712306..2712683 (-) | 378 | WP_015240208.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| RJD11_RS13660 (RJD11_13660) | comGF | 2712684..2713184 (-) | 501 | WP_256994853.1 | competence type IV pilus minor pilin ComGF | - |
| RJD11_RS13665 (RJD11_13665) | comGE | 2713093..2713407 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| RJD11_RS13670 (RJD11_13670) | comGD | 2713391..2713828 (-) | 438 | WP_015240210.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=886043 RJD11_RS13620 WP_003153105.1 2708775..2708948(+) (sinI) [Bacillus velezensis strain NDB]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=886043 RJD11_RS13620 WP_003153105.1 2708775..2708948(+) (sinI) [Bacillus velezensis strain NDB]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |