Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   RNZ43_RS12220 Genome accession   NZ_CP135143
Coordinates   2503069..2503446 (-) Length   125 a.a.
NCBI ID   WP_416405692.1    Uniprot ID   -
Organism   Bacillus velezensis strain L33a     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2498069..2508446
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RNZ43_RS12180 - 2498568..2499362 (+) 795 WP_014305407.1 YqhG family protein -
  RNZ43_RS12185 sinI 2499539..2499712 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  RNZ43_RS12190 sinR 2499746..2500081 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RNZ43_RS12195 tasA 2500129..2500914 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  RNZ43_RS12200 sipW 2500978..2501562 (-) 585 WP_012117977.1 signal peptidase I SipW -
  RNZ43_RS12205 tapA 2501534..2502205 (-) 672 WP_416405691.1 amyloid fiber anchoring/assembly protein TapA -
  RNZ43_RS12210 - 2502464..2502793 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  RNZ43_RS12215 - 2502833..2503012 (-) 180 WP_003153093.1 YqzE family protein -
  RNZ43_RS12220 comGG 2503069..2503446 (-) 378 WP_416405692.1 competence type IV pilus minor pilin ComGG Machinery gene
  RNZ43_RS12225 comGF 2503447..2503947 (-) 501 WP_014305411.1 competence type IV pilus minor pilin ComGF -
  RNZ43_RS12230 comGE 2503856..2504170 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  RNZ43_RS12235 comGD 2504154..2504591 (-) 438 WP_416405693.1 competence type IV pilus minor pilin ComGD Machinery gene
  RNZ43_RS12240 comGC 2504581..2504889 (-) 309 WP_327969171.1 competence type IV pilus major pilin ComGC Machinery gene
  RNZ43_RS12245 comGB 2504894..2505931 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  RNZ43_RS12250 comGA 2505918..2506988 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  RNZ43_RS12255 - 2507180..2508130 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14083.01 Da        Isoelectric Point: 9.7810

>NTDB_id=885595 RNZ43_RS12220 WP_416405692.1 2503069..2503446(-) (comGG) [Bacillus velezensis strain L33a]
MHKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSSHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETVSGKRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=885595 RNZ43_RS12220 WP_416405692.1 2503069..2503446(-) (comGG) [Bacillus velezensis strain L33a]
ATGCACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCAGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCACATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCAAGAGACGCGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488