Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   RNZ43_RS12185 Genome accession   NZ_CP135143
Coordinates   2499539..2499712 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain L33a     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2494539..2504712
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RNZ43_RS12170 gcvT 2495357..2496457 (-) 1101 WP_416405690.1 glycine cleavage system aminomethyltransferase GcvT -
  RNZ43_RS12175 - 2496880..2498550 (+) 1671 WP_060562612.1 DEAD/DEAH box helicase -
  RNZ43_RS12180 - 2498568..2499362 (+) 795 WP_014305407.1 YqhG family protein -
  RNZ43_RS12185 sinI 2499539..2499712 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  RNZ43_RS12190 sinR 2499746..2500081 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RNZ43_RS12195 tasA 2500129..2500914 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  RNZ43_RS12200 sipW 2500978..2501562 (-) 585 WP_012117977.1 signal peptidase I SipW -
  RNZ43_RS12205 tapA 2501534..2502205 (-) 672 WP_416405691.1 amyloid fiber anchoring/assembly protein TapA -
  RNZ43_RS12210 - 2502464..2502793 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  RNZ43_RS12215 - 2502833..2503012 (-) 180 WP_003153093.1 YqzE family protein -
  RNZ43_RS12220 comGG 2503069..2503446 (-) 378 WP_416405692.1 competence type IV pilus minor pilin ComGG Machinery gene
  RNZ43_RS12225 comGF 2503447..2503947 (-) 501 WP_014305411.1 competence type IV pilus minor pilin ComGF -
  RNZ43_RS12230 comGE 2503856..2504170 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  RNZ43_RS12235 comGD 2504154..2504591 (-) 438 WP_416405693.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=885593 RNZ43_RS12185 WP_003153105.1 2499539..2499712(+) (sinI) [Bacillus velezensis strain L33a]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=885593 RNZ43_RS12185 WP_003153105.1 2499539..2499712(+) (sinI) [Bacillus velezensis strain L33a]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702