Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   RNI18_RS18945 Genome accession   NZ_CP134775
Coordinates   3746599..3746976 (+) Length   125 a.a.
NCBI ID   WP_046559875.1    Uniprot ID   -
Organism   Bacillus velezensis strain KB21     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3741599..3751976
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RNI18_RS18910 (RNI18_18910) - 3741915..3742865 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  RNI18_RS18915 (RNI18_18915) comGA 3743057..3744127 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  RNI18_RS18920 (RNI18_18920) comGB 3744114..3745151 (+) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  RNI18_RS18925 (RNI18_18925) comGC 3745156..3745464 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  RNI18_RS18930 (RNI18_18930) comGD 3745454..3745891 (+) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  RNI18_RS18935 (RNI18_18935) comGE 3745875..3746189 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  RNI18_RS18940 (RNI18_18940) comGF 3746203..3746598 (+) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  RNI18_RS18945 (RNI18_18945) comGG 3746599..3746976 (+) 378 WP_046559875.1 competence type IV pilus minor pilin ComGG Machinery gene
  RNI18_RS18950 (RNI18_18950) - 3747033..3747212 (+) 180 WP_003153093.1 YqzE family protein -
  RNI18_RS18955 (RNI18_18955) - 3747252..3747581 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  RNI18_RS18960 (RNI18_18960) tapA 3747840..3748511 (+) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  RNI18_RS18965 (RNI18_18965) sipW 3748483..3749067 (+) 585 WP_046559873.1 signal peptidase I SipW -
  RNI18_RS18970 (RNI18_18970) tasA 3749131..3749916 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  RNI18_RS18975 (RNI18_18975) sinR 3749964..3750299 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RNI18_RS18980 (RNI18_18980) sinI 3750333..3750506 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  RNI18_RS18985 (RNI18_18985) - 3750683..3751477 (-) 795 WP_003153106.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14111.07 Da        Isoelectric Point: 9.7163

>NTDB_id=883621 RNI18_RS18945 WP_046559875.1 3746599..3746976(+) (comGG) [Bacillus velezensis strain KB21]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQPFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=883621 RNI18_RS18945 WP_046559875.1 3746599..3746976(+) (comGG) [Bacillus velezensis strain KB21]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCCTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512