Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   RNI18_RS18980 Genome accession   NZ_CP134775
Coordinates   3750333..3750506 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain KB21     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3745333..3755506
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RNI18_RS18930 (RNI18_18930) comGD 3745454..3745891 (+) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  RNI18_RS18935 (RNI18_18935) comGE 3745875..3746189 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  RNI18_RS18940 (RNI18_18940) comGF 3746203..3746598 (+) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  RNI18_RS18945 (RNI18_18945) comGG 3746599..3746976 (+) 378 WP_046559875.1 competence type IV pilus minor pilin ComGG Machinery gene
  RNI18_RS18950 (RNI18_18950) - 3747033..3747212 (+) 180 WP_003153093.1 YqzE family protein -
  RNI18_RS18955 (RNI18_18955) - 3747252..3747581 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  RNI18_RS18960 (RNI18_18960) tapA 3747840..3748511 (+) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  RNI18_RS18965 (RNI18_18965) sipW 3748483..3749067 (+) 585 WP_046559873.1 signal peptidase I SipW -
  RNI18_RS18970 (RNI18_18970) tasA 3749131..3749916 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  RNI18_RS18975 (RNI18_18975) sinR 3749964..3750299 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RNI18_RS18980 (RNI18_18980) sinI 3750333..3750506 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  RNI18_RS18985 (RNI18_18985) - 3750683..3751477 (-) 795 WP_003153106.1 YqhG family protein -
  RNI18_RS18990 (RNI18_18990) - 3751495..3753165 (-) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  RNI18_RS18995 (RNI18_18995) gcvT 3753589..3754689 (+) 1101 WP_207579557.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=883623 RNI18_RS18980 WP_003153105.1 3750333..3750506(-) (sinI) [Bacillus velezensis strain KB21]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=883623 RNI18_RS18980 WP_003153105.1 3750333..3750506(-) (sinI) [Bacillus velezensis strain KB21]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702