Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   RJY17_RS06460 Genome accession   NZ_CP134692
Coordinates   1192296..1192436 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain B5     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1187296..1197436
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RJY17_RS06435 (RJY17_06435) - 1187623..1188006 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  RJY17_RS06440 (RJY17_06440) comA 1188028..1188672 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  RJY17_RS06445 (RJY17_06445) comP 1188753..1191059 (-) 2307 WP_094032817.1 sensor histidine kinase Regulator
  RJY17_RS06450 (RJY17_06450) comX 1191078..1191254 (-) 177 WP_015240484.1 competence pheromone ComX -
  RJY17_RS06455 (RJY17_06455) - 1191269..1192144 (-) 876 WP_025285191.1 polyprenyl synthetase family protein -
  RJY17_RS06460 (RJY17_06460) degQ 1192296..1192436 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  RJY17_RS06465 (RJY17_06465) - 1192899..1193240 (+) 342 WP_007408677.1 hypothetical protein -
  RJY17_RS06470 (RJY17_06470) - 1193247..1194470 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  RJY17_RS06475 (RJY17_06475) - 1194600..1196066 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  RJY17_RS06480 (RJY17_06480) - 1196084..1196635 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  RJY17_RS06485 (RJY17_06485) - 1196732..1197130 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=882875 RJY17_RS06460 WP_003152043.1 1192296..1192436(-) (degQ) [Bacillus velezensis strain B5]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=882875 RJY17_RS06460 WP_003152043.1 1192296..1192436(-) (degQ) [Bacillus velezensis strain B5]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891