Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | WOC54_RS12220 | Genome accession | NZ_CP150747 |
| Coordinates | 2405696..2406007 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain TUM22701 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2400696..2411007
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC54_RS12190 (WOC54_12220) | - | 2401479..2401682 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| WOC54_RS12195 (WOC54_12225) | - | 2401679..2402665 (+) | 987 | WP_000161311.1 | ROK family glucokinase | - |
| WOC54_RS12200 (WOC54_12230) | - | 2402665..2402994 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| WOC54_RS12205 (WOC54_12235) | - | 2402991..2403614 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| WOC54_RS12210 (WOC54_12240) | comGA | 2403666..2404640 (+) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| WOC54_RS12215 (WOC54_12245) | comGB | 2404612..2405682 (+) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| WOC54_RS12220 (WOC54_12250) | comGC | 2405696..2406007 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| WOC54_RS12225 (WOC54_12255) | comGD | 2405985..2406431 (+) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| WOC54_RS12230 (WOC54_12260) | comGE | 2406418..2406717 (+) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| WOC54_RS12235 (WOC54_12265) | comGF | 2406635..2407132 (+) | 498 | WP_001788897.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| WOC54_RS12240 (WOC54_12270) | - | 2407229..2407375 (+) | 147 | WP_001792109.1 | hypothetical protein | - |
| WOC54_RS12245 (WOC54_12275) | - | 2407365..2407889 (+) | 525 | WP_001015120.1 | shikimate kinase | - |
| WOC54_RS12250 (WOC54_12280) | gcvT | 2408048..2409139 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| WOC54_RS12255 (WOC54_12285) | gcvPA | 2409159..2410505 (+) | 1347 | WP_341262150.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=878352 WOC54_RS12220 WP_000472256.1 2405696..2406007(+) (comGC) [Staphylococcus aureus strain TUM22701]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=878352 WOC54_RS12220 WP_000472256.1 2405696..2406007(+) (comGC) [Staphylococcus aureus strain TUM22701]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |