Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   RIM73_RS08945 Genome accession   NZ_CP133956
Coordinates   1866575..1867063 (-) Length   162 a.a.
NCBI ID   WP_012679031.1    Uniprot ID   C0MB80
Organism   Streptococcus equi subsp. equi strain HTP232     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1861861..1920760 1866575..1867063 within 0
IScluster/Tn 1864629..1865971 1866575..1867063 flank 604


Gene organization within MGE regions


Location: 1861861..1920760
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RIM73_RS08920 (RIM73_08920) - 1862624..1863568 (+) 945 WP_012678501.1 magnesium transporter CorA family protein -
  RIM73_RS08925 (RIM73_08925) - 1863593..1863730 (-) 138 WP_154235407.1 hypothetical protein -
  RIM73_RS08930 (RIM73_08930) - 1863827..1864477 (+) 651 WP_012679033.1 DUF1129 domain-containing protein -
  RIM73_RS08940 (RIM73_08940) rpsR 1866177..1866416 (-) 240 WP_002983142.1 30S ribosomal protein S18 -
  RIM73_RS08945 (RIM73_08945) ssbA 1866575..1867063 (-) 489 WP_012679031.1 single-stranded DNA-binding protein Machinery gene
  RIM73_RS08950 (RIM73_08950) rpsF 1867082..1867372 (-) 291 WP_012678504.1 30S ribosomal protein S6 -
  RIM73_RS08955 (RIM73_08955) - 1868434..1868659 (-) 226 Protein_1706 HicB family protein -
  RIM73_RS08960 (RIM73_08960) mutY 1868748..1869896 (+) 1149 WP_012679029.1 A/G-specific adenine glycosylase -
  RIM73_RS08965 (RIM73_08965) - 1870668..1871873 (+) 1206 WP_317583074.1 LPXTG cell wall anchor domain-containing protein -
  RIM73_RS08970 (RIM73_08970) trxA 1872119..1872433 (-) 315 WP_012514992.1 thioredoxin -
  RIM73_RS08975 (RIM73_08975) - 1872613..1873932 (+) 1320 WP_012679026.1 FAD-containing oxidoreductase -
  RIM73_RS08980 (RIM73_08980) - 1874272..1876608 (-) 2337 WP_012679025.1 endonuclease MutS2 -
  RIM73_RS08985 (RIM73_08985) - 1876681..1877226 (-) 546 WP_021320369.1 CvpA family protein -
  RIM73_RS08990 (RIM73_08990) - 1877226..1877537 (-) 312 WP_012514987.1 hypothetical protein -
  RIM73_RS08995 (RIM73_08995) rnhC 1877655..1878563 (+) 909 WP_042356750.1 ribonuclease HIII -
  RIM73_RS09000 (RIM73_09000) lepB 1878588..1879187 (+) 600 WP_012514985.1 signal peptidase I -
  RIM73_RS09005 (RIM73_09005) - 1879416..1881815 (+) 2400 WP_050316029.1 ATP-dependent RecD-like DNA helicase -
  RIM73_RS09010 (RIM73_09010) - 1881911..1882396 (+) 486 WP_012679021.1 hypothetical protein -
  RIM73_RS09015 (RIM73_09015) dinB 1882539..1883642 (-) 1104 WP_012679020.1 DNA polymerase IV -
  RIM73_RS09020 (RIM73_09020) pflB 1883851..1886175 (+) 2325 WP_012678516.1 formate C-acetyltransferase -
  RIM73_RS09025 (RIM73_09025) - 1886480..1886758 (+) 279 WP_042356748.1 hypothetical protein -
  RIM73_RS09030 (RIM73_09030) - 1886922..1887863 (-) 942 WP_012679019.1 serine hydrolase domain-containing protein -
  RIM73_RS09035 (RIM73_09035) - 1887860..1888615 (-) 756 WP_317582810.1 CppA N-terminal domain-containing protein -
  RIM73_RS09040 (RIM73_09040) gla 1889108..1889956 (-) 849 WP_012679017.1 aquaglyceroporin Gla -
  RIM73_RS09045 (RIM73_09045) - 1890058..1890510 (-) 453 WP_012679016.1 universal stress protein -
  RIM73_RS09050 (RIM73_09050) - 1890530..1891729 (-) 1200 WP_317582811.1 MFS transporter -
  RIM73_RS09055 (RIM73_09055) - 1891898..1892557 (+) 660 WP_012514975.1 Crp/Fnr family transcriptional regulator -
  RIM73_RS09060 (RIM73_09060) - 1892578..1894863 (+) 2286 WP_012679014.1 Xaa-Pro dipeptidyl-peptidase -
  RIM73_RS09065 (RIM73_09065) - 1894969..1895361 (-) 393 WP_012679013.1 pyridoxamine 5'-phosphate oxidase family protein -
  RIM73_RS09070 (RIM73_09070) - 1895550..1895772 (-) 223 Protein_1729 helix-turn-helix domain-containing protein -
  RIM73_RS09075 (RIM73_09075) - 1895951..1896325 (+) 375 WP_317582813.1 helix-turn-helix transcriptional regulator -
  RIM73_RS09080 (RIM73_09080) - 1896583..1897260 (-) 678 WP_012679011.1 type II CAAX prenyl endopeptidase Rce1 family protein -
  RIM73_RS09085 (RIM73_09085) - 1897882..1899390 (-) 1509 WP_012679010.1 helix-turn-helix domain-containing protein -
  RIM73_RS09090 (RIM73_09090) - 1899641..1900537 (+) 897 WP_052292771.1 thioester-forming surface-anchored protein -
  RIM73_RS09095 (RIM73_09095) - 1900585..1900797 (+) 213 WP_173476773.1 fibronectin-binding protein -
  RIM73_RS09100 (RIM73_09100) - 1900724..1901530 (+) 807 WP_317582814.1 LPXTG cell wall anchor domain-containing protein -
  RIM73_RS09105 (RIM73_09105) - 1901902..1902948 (-) 1047 WP_317582815.1 HAMP domain-containing sensor histidine kinase -
  RIM73_RS09110 (RIM73_09110) - 1902950..1903636 (-) 687 WP_021320358.1 response regulator transcription factor -
  RIM73_RS09115 (RIM73_09115) - 1903775..1904371 (-) 597 WP_394854531.1 hypothetical protein -
  RIM73_RS09120 (RIM73_09120) - 1904760..1905059 (+) 300 WP_012514952.1 YbaB/EbfC family nucleoid-associated protein -
  RIM73_RS09125 (RIM73_09125) - 1905101..1905823 (-) 723 WP_012679006.1 MerR family transcriptional regulator -
  RIM73_RS09130 (RIM73_09130) - 1905927..1906514 (-) 588 WP_012679005.1 3'-5' exonuclease -
  RIM73_RS09135 (RIM73_09135) - 1906559..1907089 (-) 531 WP_014622285.1 DUF536 domain-containing protein -
  RIM73_RS09140 (RIM73_09140) - 1907215..1908387 (+) 1173 WP_317582816.1 NAD(P)/FAD-dependent oxidoreductase -
  RIM73_RS09145 (RIM73_09145) rpsN 1908581..1908850 (+) 270 WP_012678537.1 30S ribosomal protein S14 -
  RIM73_RS09150 (RIM73_09150) - 1908867..1909088 (-) 222 WP_041790590.1 hypothetical protein -
  RIM73_RS09155 (RIM73_09155) - 1909245..1910273 (-) 1029 WP_042356741.1 YdcF family protein -
  RIM73_RS09160 (RIM73_09160) tsaD 1910295..1911311 (-) 1017 WP_012678539.1 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD -
  RIM73_RS09165 (RIM73_09165) rimI 1911301..1911726 (-) 426 WP_317582817.1 ribosomal protein S18-alanine N-acetyltransferase -
  RIM73_RS09170 (RIM73_09170) tsaB 1911729..1912427 (-) 699 WP_012679000.1 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB -
  RIM73_RS09175 (RIM73_09175) - 1912713..1912943 (+) 231 WP_012514942.1 DNA-dependent RNA polymerase subunit epsilon -
  RIM73_RS09180 (RIM73_09180) rnjA 1912945..1914627 (+) 1683 WP_012514941.1 ribonuclease J1 -
  RIM73_RS09185 (RIM73_09185) amiF 1915256..1916191 (-) 936 WP_317582818.1 ATP-binding cassette domain-containing protein Regulator
  RIM73_RS09190 (RIM73_09190) oppD 1916191..1917237 (-) 1047 WP_111689823.1 ABC transporter ATP-binding protein Regulator
  RIM73_RS09195 (RIM73_09195) - 1917249..1918280 (-) 1032 WP_012678997.1 ABC transporter permease -
  RIM73_RS09200 (RIM73_09200) - 1918290..1919204 (-) 915 WP_012678996.1 ABC transporter permease -

Sequence


Protein


Download         Length: 162 a.a.        Molecular weight: 17750.59 Da        Isoelectric Point: 5.1951

>NTDB_id=877935 RIM73_RS08945 WP_012679031.1 1866575..1867063(-) (ssbA) [Streptococcus equi subsp. equi strain HTP232]
MINNVVLVGRMTKDAELRYTPSQVAVATFTLAVNRAFKSQNGEREADFINCVIWRQQAENLANWAKKGALIGITGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRATREANSSGSYGGGFNSSPATNSYSAPAQQTPNFGRDGSPFGGSNPMDISDDDL
PF

Nucleotide


Download         Length: 489 bp        

>NTDB_id=877935 RIM73_RS08945 WP_012679031.1 1866575..1867063(-) (ssbA) [Streptococcus equi subsp. equi strain HTP232]
ATGATTAATAATGTAGTACTAGTTGGTCGTATGACCAAGGACGCAGAGCTTCGATACACTCCAAGTCAGGTGGCAGTTGC
TACGTTTACACTTGCTGTTAATCGCGCCTTTAAGAGCCAAAATGGTGAGCGCGAAGCGGATTTCATTAACTGTGTGATCT
GGCGTCAGCAAGCTGAAAATTTAGCTAACTGGGCTAAAAAGGGTGCCTTGATTGGGATTACGGGACGTATTCAGACTCGT
AACTACGAAAACCAACAGGGGCAGCGTGTGTATGTAACCGAGGTTGTTGCAGATAATTTCCAAATGCTGGAAAGTCGTGC
TACACGTGAGGCGAACTCGTCTGGCTCATATGGTGGTGGTTTTAATAGCTCACCGGCAACCAATAGCTATTCAGCGCCTG
CTCAGCAAACACCTAACTTTGGCAGAGATGGAAGTCCATTTGGCGGCTCAAATCCAATGGATATTTCAGATGACGATCTT
CCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB C0MB80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

58.046

100

0.623

  ssb Latilactobacillus sakei subsp. sakei 23K

57.895

100

0.611

  ssbB Bacillus subtilis subsp. subtilis str. 168

54.955

68.519

0.377