Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   RFN60_RS12230 Genome accession   NZ_CP133653
Coordinates   2396496..2396879 (-) Length   127 a.a.
NCBI ID   WP_015251713.1    Uniprot ID   -
Organism   Bacillus subtilis strain CP38     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2391496..2401879
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RFN60_RS12190 (RFN60_12190) sinI 2392429..2392602 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  RFN60_RS12195 (RFN60_12195) sinR 2392636..2392971 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  RFN60_RS12200 (RFN60_12200) tasA 2393064..2393849 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  RFN60_RS12205 (RFN60_12205) sipW 2393913..2394485 (-) 573 WP_003230181.1 signal peptidase I SipW -
  RFN60_RS12210 (RFN60_12210) tapA 2394469..2395230 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  RFN60_RS12215 (RFN60_12215) yqzG 2395502..2395828 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  RFN60_RS12220 (RFN60_12220) spoIITA 2395870..2396049 (-) 180 WP_029726723.1 YqzE family protein -
  RFN60_RS12225 (RFN60_12225) comGG 2396121..2396495 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  RFN60_RS12230 (RFN60_12230) comGF 2396496..2396879 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  RFN60_RS12235 (RFN60_12235) comGE 2396905..2397252 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene
  RFN60_RS12240 (RFN60_12240) comGD 2397236..2397667 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  RFN60_RS12245 (RFN60_12245) comGC 2397657..2397953 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  RFN60_RS12250 (RFN60_12250) comGB 2397967..2399004 (-) 1038 WP_044052501.1 comG operon protein ComGB Machinery gene
  RFN60_RS12255 (RFN60_12255) comGA 2398991..2400061 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  RFN60_RS12260 (RFN60_12260) - 2400274..2400471 (-) 198 WP_014480259.1 CBS domain-containing protein -
  RFN60_RS12265 (RFN60_12265) corA 2400473..2401426 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14280.43 Da        Isoelectric Point: 6.4838

>NTDB_id=875576 RFN60_RS12230 WP_015251713.1 2396496..2396879(-) (comGF) [Bacillus subtilis strain CP38]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=875576 RFN60_RS12230 WP_015251713.1 2396496..2396879(-) (comGF) [Bacillus subtilis strain CP38]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992