Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   RFN60_RS12190 Genome accession   NZ_CP133653
Coordinates   2392429..2392602 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain CP38     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2387429..2397602
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RFN60_RS12175 (RFN60_12175) gcvT 2388228..2389316 (-) 1089 WP_029317919.1 glycine cleavage system aminomethyltransferase GcvT -
  RFN60_RS12180 (RFN60_12180) hepAA 2389758..2391431 (+) 1674 WP_029726726.1 DEAD/DEAH box helicase -
  RFN60_RS12185 (RFN60_12185) yqhG 2391452..2392246 (+) 795 WP_003230200.1 YqhG family protein -
  RFN60_RS12190 (RFN60_12190) sinI 2392429..2392602 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  RFN60_RS12195 (RFN60_12195) sinR 2392636..2392971 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  RFN60_RS12200 (RFN60_12200) tasA 2393064..2393849 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  RFN60_RS12205 (RFN60_12205) sipW 2393913..2394485 (-) 573 WP_003230181.1 signal peptidase I SipW -
  RFN60_RS12210 (RFN60_12210) tapA 2394469..2395230 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  RFN60_RS12215 (RFN60_12215) yqzG 2395502..2395828 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  RFN60_RS12220 (RFN60_12220) spoIITA 2395870..2396049 (-) 180 WP_029726723.1 YqzE family protein -
  RFN60_RS12225 (RFN60_12225) comGG 2396121..2396495 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  RFN60_RS12230 (RFN60_12230) comGF 2396496..2396879 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  RFN60_RS12235 (RFN60_12235) comGE 2396905..2397252 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=875573 RFN60_RS12190 WP_003230187.1 2392429..2392602(+) (sinI) [Bacillus subtilis strain CP38]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=875573 RFN60_RS12190 WP_003230187.1 2392429..2392602(+) (sinI) [Bacillus subtilis strain CP38]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1