Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   RCF35_RS16875 Genome accession   NZ_CP133277
Coordinates   3447508..3447885 (-) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain NBNZ-0060     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3442508..3452885
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RCF35_RS16835 (RCF35_16835) - 3443005..3443799 (+) 795 WP_007612541.1 YqhG family protein -
  RCF35_RS16840 (RCF35_16840) sinI 3443976..3444149 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  RCF35_RS16845 (RCF35_16845) sinR 3444183..3444518 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RCF35_RS16850 (RCF35_16850) tasA 3444566..3445351 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  RCF35_RS16855 (RCF35_16855) sipW 3445416..3446000 (-) 585 WP_032874025.1 signal peptidase I SipW -
  RCF35_RS16860 (RCF35_16860) tapA 3445972..3446643 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  RCF35_RS16865 (RCF35_16865) - 3446902..3447231 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  RCF35_RS16870 (RCF35_16870) - 3447272..3447451 (-) 180 WP_022552966.1 YqzE family protein -
  RCF35_RS16875 (RCF35_16875) comGG 3447508..3447885 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  RCF35_RS16880 (RCF35_16880) comGF 3447886..3448386 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  RCF35_RS16885 (RCF35_16885) comGE 3448295..3448609 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  RCF35_RS16890 (RCF35_16890) comGD 3448593..3449030 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  RCF35_RS16895 (RCF35_16895) comGC 3449020..3449328 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  RCF35_RS16900 (RCF35_16900) comGB 3449333..3450370 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  RCF35_RS16905 (RCF35_16905) comGA 3450357..3451427 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  RCF35_RS16910 (RCF35_16910) - 3451624..3452574 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=873227 RCF35_RS16875 WP_032874019.1 3447508..3447885(-) (comGG) [Bacillus velezensis strain NBNZ-0060]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=873227 RCF35_RS16875 WP_032874019.1 3447508..3447885(-) (comGG) [Bacillus velezensis strain NBNZ-0060]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488