Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | RB208_RS11900 | Genome accession | NZ_CP133147 |
| Coordinates | 2474843..2475016 (+) | Length | 57 a.a. |
| NCBI ID | WP_032874029.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain Bacillius velezensis JYC520 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2469843..2480016
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RB208_RS11885 (RB208_11890) | gcvT | 2470657..2471757 (-) | 1101 | WP_032874033.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| RB208_RS11890 (RB208_11895) | - | 2472180..2473850 (+) | 1671 | WP_032874031.1 | DEAD/DEAH box helicase | - |
| RB208_RS11895 (RB208_11900) | - | 2473872..2474666 (+) | 795 | WP_007612541.1 | YqhG family protein | - |
| RB208_RS11900 (RB208_11905) | sinI | 2474843..2475016 (+) | 174 | WP_032874029.1 | anti-repressor SinI | Regulator |
| RB208_RS11905 (RB208_11910) | sinR | 2475050..2475385 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| RB208_RS11910 (RB208_11915) | tasA | 2475433..2476218 (-) | 786 | WP_032874027.1 | biofilm matrix protein TasA | - |
| RB208_RS11915 (RB208_11920) | sipW | 2476283..2476867 (-) | 585 | WP_032874025.1 | signal peptidase I SipW | - |
| RB208_RS11920 (RB208_11925) | tapA | 2476839..2477510 (-) | 672 | WP_032874023.1 | amyloid fiber anchoring/assembly protein TapA | - |
| RB208_RS11925 (RB208_11930) | - | 2477769..2478098 (+) | 330 | WP_032874021.1 | DUF3889 domain-containing protein | - |
| RB208_RS11930 (RB208_11935) | - | 2478139..2478318 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| RB208_RS11935 (RB208_11940) | comGG | 2478375..2478752 (-) | 378 | WP_032874019.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| RB208_RS11940 (RB208_11945) | comGF | 2478753..2479217 (-) | 465 | WP_223813077.1 | competence type IV pilus minor pilin ComGF | - |
| RB208_RS11945 (RB208_11950) | comGE | 2479162..2479476 (-) | 315 | WP_032874016.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| RB208_RS11950 (RB208_11955) | comGD | 2479460..2479897 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6658.66 Da Isoelectric Point: 9.8168
>NTDB_id=872101 RB208_RS11900 WP_032874029.1 2474843..2475016(+) (sinI) [Bacillus velezensis strain Bacillius velezensis JYC520]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=872101 RB208_RS11900 WP_032874029.1 2474843..2475016(+) (sinI) [Bacillus velezensis strain Bacillius velezensis JYC520]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |