Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   RB208_RS11945 Genome accession   NZ_CP133147
Coordinates   2479162..2479476 (-) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain Bacillius velezensis JYC520     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2474162..2484476
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RB208_RS11900 (RB208_11905) sinI 2474843..2475016 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  RB208_RS11905 (RB208_11910) sinR 2475050..2475385 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  RB208_RS11910 (RB208_11915) tasA 2475433..2476218 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  RB208_RS11915 (RB208_11920) sipW 2476283..2476867 (-) 585 WP_032874025.1 signal peptidase I SipW -
  RB208_RS11920 (RB208_11925) tapA 2476839..2477510 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  RB208_RS11925 (RB208_11930) - 2477769..2478098 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  RB208_RS11930 (RB208_11935) - 2478139..2478318 (-) 180 WP_022552966.1 YqzE family protein -
  RB208_RS11935 (RB208_11940) comGG 2478375..2478752 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  RB208_RS11940 (RB208_11945) comGF 2478753..2479217 (-) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  RB208_RS11945 (RB208_11950) comGE 2479162..2479476 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  RB208_RS11950 (RB208_11955) comGD 2479460..2479897 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  RB208_RS11955 (RB208_11960) comGC 2479887..2480195 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  RB208_RS11960 (RB208_11965) comGB 2480200..2481237 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  RB208_RS11965 (RB208_11970) comGA 2481224..2482294 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  RB208_RS11970 (RB208_11975) - 2482491..2483441 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=872104 RB208_RS11945 WP_032874016.1 2479162..2479476(-) (comGE) [Bacillus velezensis strain Bacillius velezensis JYC520]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=872104 RB208_RS11945 WP_032874016.1 2479162..2479476(-) (comGE) [Bacillus velezensis strain Bacillius velezensis JYC520]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481