Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   RBH91_RS17725 Genome accession   NZ_CP133085
Coordinates   3555972..3556112 (-) Length   46 a.a.
NCBI ID   WP_076762028.1    Uniprot ID   A0A1R1QE59
Organism   Bacillus swezeyi strain EA208     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3550972..3561112
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RBH91_RS17700 - 3551263..3551652 (-) 390 WP_307892377.1 hotdog fold thioesterase -
  RBH91_RS17705 comA 3551670..3552308 (-) 639 WP_076762176.1 response regulator transcription factor Regulator
  RBH91_RS17710 comP 3552395..3554710 (-) 2316 WP_307892378.1 ATP-binding protein Regulator
  RBH91_RS17715 comX 3554728..3554901 (-) 174 WP_307892379.1 competence pheromone ComX -
  RBH91_RS17720 - 3554885..3555784 (-) 900 WP_307892380.1 polyprenyl synthetase family protein -
  RBH91_RS17725 degQ 3555972..3556112 (-) 141 WP_076762028.1 degradation enzyme regulation protein DegQ Regulator
  RBH91_RS17730 - 3556598..3556945 (+) 348 WP_244948947.1 hypothetical protein -
  RBH91_RS17735 - 3556994..3558211 (-) 1218 WP_076762030.1 EAL and HDOD domain-containing protein -
  RBH91_RS17740 - 3558391..3559860 (-) 1470 WP_076762031.1 nicotinate phosphoribosyltransferase -
  RBH91_RS17745 - 3559878..3560429 (-) 552 WP_307892381.1 isochorismatase family cysteine hydrolase -
  RBH91_RS17750 - 3560615..3561016 (-) 402 WP_307892382.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5746.62 Da        Isoelectric Point: 9.8829

>NTDB_id=871761 RBH91_RS17725 WP_076762028.1 3555972..3556112(-) (degQ) [Bacillus swezeyi strain EA208]
MKKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=871761 RBH91_RS17725 WP_076762028.1 3555972..3556112(-) (degQ) [Bacillus swezeyi strain EA208]
GTGAAAAAGCAACAAATTGAAGAATTAAAACAATTGCTTTGGCGGCTTGAAAATGAAATTAGAGAAACAAAGGACTCCTT
ACGCAAGATTAACAAAAGTATCGATCAATACGATAAATACACATATTTAAAAACCTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1R1QE59

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

69.231

84.783

0.587