Detailed information NTG0870569

Bioinformatically predicted

Overview

• Name: comYF
• Type: Machinery gene
• Locus tag: RA106_RS08780
• Genome accession: NZ_CP132900
• Coordinates: 1697847..1698284 (-)
• Length: 145 a.a.
• NCBI ID: WP_011681686.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain CICC 20372
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1692847..1703284

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RA106_RS08740 (RA106_08735)	-	1692910..1693572 (-)	663	WP_011681679.1	CPBP family intramembrane glutamic endopeptidase	-
RA106_RS08745 (RA106_08740)	-	1693669..1694112 (-)	444	WP_011681680.1	hypothetical protein	-
RA106_RS08750 (RA106_08745)	-	1694186..1694524 (-)	339	WP_224103197.1	CPBP family intramembrane glutamic endopeptidase	-
RA106_RS08755 (RA106_08750)	-	1694568..1694843 (-)	276	WP_011681681.1	hypothetical protein	-
RA106_RS08760 (RA106_08755)	-	1694855..1695053 (-)	199	Protein_1683	helix-turn-helix transcriptional regulator	-
RA106_RS08765 (RA106_08760)	-	1695302..1696495 (-)	1194	WP_014608740.1	acetate kinase	-
RA106_RS08770 (RA106_08765)	comYH	1696551..1697507 (-)	957	WP_011681684.1	class I SAM-dependent methyltransferase	Machinery gene
RA106_RS08775 (RA106_08770)	comGG	1697552..1697869 (-)	318	WP_011681685.1	competence type IV pilus minor pilin ComGG	-
RA106_RS08780 (RA106_08775)	comYF	1697847..1698284 (-)	438	WP_011681686.1	competence type IV pilus minor pilin ComGF	Machinery gene
RA106_RS08785 (RA106_08780)	comGE	1698268..1698561 (-)	294	WP_024704238.1	competence type IV pilus minor pilin ComGE	-
RA106_RS08790 (RA106_08785)	comYD	1698533..1698961 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
RA106_RS08795 (RA106_08790)	comYC	1698921..1699247 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
RA106_RS08800 (RA106_08795)	comYB	1699244..1700344 (-)	1101	WP_120764773.1	competence type IV pilus assembly protein ComGB	Machinery gene
RA106_RS08805 (RA106_08800)	comGA/cglA/cilD	1700226..1701167 (-)	942	WP_022096896.1	competence type IV pilus ATPase ComGA	Machinery gene
RA106_RS08810 (RA106_08805)	-	1701248..1701610 (-)	363	WP_014622006.1	DUF1033 family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16375.85 Da
• Isoelectric Point: 8.4500

>NTDB_id=870569 RA106_RS08780 WP_011681686.1 1697847..1698284(-) (comYF) [Streptococcus thermophilus strain CICC 20372]
MYLSSKLRAFTLLECLVALLVIAGSVQVYQGLTTVLVSNVKQVRQQENQDWLLFVQQMEAELEGCQLVKVEGNKLYVKQD
NQDLAFGLSSASDFRKTNADGRGYQPMLFDVKSSKVSQKNQIVTIQVTLKNELQRSFVYAFEKTG

Nucleotide

• Length: 438 bp

>NTDB_id=870569 RA106_RS08780 WP_011681686.1 1697847..1698284(-) (comYF) [Streptococcus thermophilus strain CICC 20372]
ATGTATCTAAGCAGTAAGCTGCGTGCCTTTACCCTCTTGGAATGTCTAGTGGCCTTGTTGGTCATTGCTGGCTCAGTTCA
AGTTTATCAAGGGTTAACCACTGTACTTGTGAGTAATGTTAAGCAGGTAAGACAACAAGAAAACCAAGATTGGCTTCTAT
TTGTTCAACAAATGGAGGCAGAATTAGAAGGATGTCAGTTGGTCAAGGTAGAGGGGAACAAACTCTATGTCAAGCAGGAT
AATCAAGACTTGGCTTTTGGTCTTTCAAGTGCCTCTGATTTTCGAAAAACAAATGCTGATGGTCGAGGTTATCAACCAAT
GCTTTTCGATGTCAAATCTAGTAAGGTAAGTCAAAAGAACCAGATAGTTACCATCCAAGTGACTCTTAAAAATGAACTAC
AAAGGAGTTTTGTTTATGCTTTTGAAAAAACAGGTTAG

Domains

Predicted by InterproScan.

• Putative Competence protein ComGF (ComGF) (39-134)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYF	Streptococcus mutans UA140	58.156	97.241	0.566
comYF	Streptococcus mutans UA159	57.447	97.241	0.559
comGF/cglF	Streptococcus pneumoniae D39	49.286	96.552	0.476
comGF/cglF	Streptococcus pneumoniae Rx1	49.286	96.552	0.476
comGF/cglF	Streptococcus pneumoniae R6	49.286	96.552	0.476
comGF/cglF	Streptococcus pneumoniae TIGR4	49.286	96.552	0.476
comGF/cglF	Streptococcus mitis NCTC 12261	47.518	97.241	0.462
comGF/cglF	Streptococcus mitis SK321	46.809	97.241	0.455
comGF	Lactococcus lactis subsp. cremoris KW2	45.324	95.862	0.434