Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | RAM41_RS06655 | Genome accession | NZ_CP132391 |
| Coordinates | 1362431..1362892 (+) | Length | 153 a.a. |
| NCBI ID | WP_100006931.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain CUVET16-115 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1354204..1394451 | 1362431..1362892 | within | 0 |
Gene organization within MGE regions
Location: 1354204..1394451
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RAM41_RS06590 (RAM41_06555) | - | 1354204..1355427 (-) | 1224 | WP_153934390.1 | tyrosine-type recombinase/integrase | - |
| RAM41_RS06595 (RAM41_06560) | - | 1355486..1356127 (-) | 642 | WP_153934396.1 | hypothetical protein | - |
| RAM41_RS06600 (RAM41_06565) | - | 1356173..1356634 (-) | 462 | WP_130922120.1 | ImmA/IrrE family metallo-endopeptidase | - |
| RAM41_RS06605 (RAM41_06570) | - | 1356653..1356985 (-) | 333 | WP_130922119.1 | helix-turn-helix domain-containing protein | - |
| RAM41_RS06610 (RAM41_06575) | - | 1357149..1357358 (+) | 210 | WP_130922118.1 | helix-turn-helix domain-containing protein | - |
| RAM41_RS06615 (RAM41_06580) | - | 1357549..1357812 (+) | 264 | WP_153934392.1 | helix-turn-helix domain-containing protein | - |
| RAM41_RS06620 (RAM41_06585) | - | 1357827..1358003 (+) | 177 | WP_172968882.1 | hypothetical protein | - |
| RAM41_RS06625 (RAM41_06590) | - | 1358005..1358301 (+) | 297 | WP_103866757.1 | DUF2482 family protein | - |
| RAM41_RS06630 (RAM41_06595) | - | 1358388..1358645 (+) | 258 | WP_404951792.1 | DUF1108 family protein | - |
| RAM41_RS06635 (RAM41_06600) | - | 1358661..1360613 (+) | 1953 | WP_404951794.1 | AAA family ATPase | - |
| RAM41_RS06640 | - | 1360606..1360803 (+) | 198 | WP_198456198.1 | helix-turn-helix domain-containing protein | - |
| RAM41_RS06645 (RAM41_06605) | - | 1360817..1361731 (+) | 915 | WP_404951795.1 | recombinase RecT | - |
| RAM41_RS06650 (RAM41_06610) | - | 1361794..1362429 (+) | 636 | WP_100006932.1 | MBL fold metallo-hydrolase | - |
| RAM41_RS06655 (RAM41_06615) | ssb | 1362431..1362892 (+) | 462 | WP_100006931.1 | single-stranded DNA-binding protein | Machinery gene |
| RAM41_RS06660 (RAM41_06620) | - | 1362907..1363314 (+) | 408 | WP_198456199.1 | hypothetical protein | - |
| RAM41_RS06665 (RAM41_06625) | - | 1363330..1364049 (+) | 720 | WP_037542879.1 | hypothetical protein | - |
| RAM41_RS06670 (RAM41_06630) | - | 1364098..1364865 (+) | 768 | WP_049770167.1 | DnaD domain-containing protein | - |
| RAM41_RS06675 (RAM41_06635) | - | 1364880..1365662 (+) | 783 | WP_015729208.1 | ATP-binding protein | - |
| RAM41_RS06680 (RAM41_06640) | - | 1365826..1366032 (+) | 207 | WP_015729207.1 | hypothetical protein | - |
| RAM41_RS06685 (RAM41_06645) | - | 1366182..1366433 (+) | 252 | WP_015729206.1 | hypothetical protein | - |
| RAM41_RS06690 (RAM41_06650) | - | 1366466..1366660 (+) | 195 | WP_049770177.1 | SAV1978 family virulence-associated passenger protein | - |
| RAM41_RS06695 (RAM41_06655) | - | 1366666..1366851 (+) | 186 | WP_015729205.1 | hypothetical protein | - |
| RAM41_RS06700 (RAM41_06660) | - | 1366848..1367198 (+) | 351 | WP_015729204.1 | YopX family protein | - |
| RAM41_RS06705 (RAM41_06665) | - | 1367241..1367603 (+) | 363 | WP_015729203.1 | hypothetical protein | - |
| RAM41_RS06710 (RAM41_06670) | - | 1367604..1367924 (+) | 321 | WP_404951798.1 | hypothetical protein | - |
| RAM41_RS06715 (RAM41_06675) | - | 1367926..1368459 (+) | 534 | WP_015729201.1 | MazG-like family protein | - |
| RAM41_RS06720 (RAM41_06680) | - | 1368480..1368923 (+) | 444 | WP_041614853.1 | hypothetical protein | - |
| RAM41_RS06725 (RAM41_06685) | - | 1369048..1369461 (+) | 414 | WP_037542896.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| RAM41_RS06730 (RAM41_06690) | - | 1369725..1370060 (+) | 336 | WP_015729199.1 | HNH endonuclease | - |
| RAM41_RS06735 (RAM41_06695) | - | 1370196..1370495 (+) | 300 | WP_100006922.1 | P27 family phage terminase small subunit | - |
| RAM41_RS06740 (RAM41_06700) | - | 1370492..1372132 (+) | 1641 | WP_404951801.1 | terminase TerL endonuclease subunit | - |
| RAM41_RS06745 (RAM41_06705) | - | 1372147..1373301 (+) | 1155 | WP_103866786.1 | phage portal protein | - |
| RAM41_RS06750 (RAM41_06710) | - | 1373291..1374013 (+) | 723 | WP_103866788.1 | head maturation protease, ClpP-related | - |
| RAM41_RS06755 (RAM41_06715) | - | 1374042..1375169 (+) | 1128 | WP_015729194.1 | phage major capsid protein | - |
| RAM41_RS06760 (RAM41_06720) | - | 1375238..1375534 (+) | 297 | WP_015729193.1 | hypothetical protein | - |
| RAM41_RS06765 (RAM41_06725) | - | 1375515..1375877 (+) | 363 | WP_037542906.1 | hypothetical protein | - |
| RAM41_RS06770 (RAM41_06730) | - | 1375874..1376275 (+) | 402 | WP_037542908.1 | hypothetical protein | - |
| RAM41_RS06775 (RAM41_06735) | - | 1376277..1376672 (+) | 396 | WP_037542910.1 | hypothetical protein | - |
| RAM41_RS06780 (RAM41_06740) | - | 1376712..1377392 (+) | 681 | WP_103866790.1 | major tail protein | - |
| RAM41_RS06785 (RAM41_06745) | - | 1377487..1377948 (+) | 462 | WP_015729188.1 | Ig-like domain-containing protein | - |
| RAM41_RS06790 (RAM41_06750) | gpG | 1378056..1378406 (+) | 351 | WP_103866792.1 | phage tail assembly chaperone G | - |
| RAM41_RS06795 (RAM41_06755) | - | 1378448..1378603 (+) | 156 | WP_168429803.1 | hypothetical protein | - |
| RAM41_RS06800 (RAM41_06760) | - | 1378617..1384205 (+) | 5589 | WP_404951806.1 | phage tail tape measure protein | - |
| RAM41_RS06805 (RAM41_06765) | - | 1384208..1385032 (+) | 825 | WP_015729184.1 | phage tail domain-containing protein | - |
| RAM41_RS06810 (RAM41_06770) | - | 1385033..1386607 (+) | 1575 | WP_099984955.1 | prophage endopeptidase tail family protein | - |
| RAM41_RS06815 (RAM41_06775) | - | 1386594..1386794 (+) | 201 | WP_015729182.1 | hypothetical protein | - |
| RAM41_RS06820 (RAM41_06780) | - | 1386801..1387421 (+) | 621 | WP_015729181.1 | hypothetical protein | - |
| RAM41_RS06825 (RAM41_06785) | - | 1387433..1388464 (+) | 1032 | WP_037542926.1 | SGNH/GDSL hydrolase family protein | - |
| RAM41_RS06830 (RAM41_06790) | - | 1388481..1389752 (+) | 1272 | WP_037542928.1 | phage baseplate upper protein | - |
| RAM41_RS06835 (RAM41_06795) | - | 1389823..1391823 (+) | 2001 | WP_015729177.1 | BppU family phage baseplate upper protein | - |
| RAM41_RS06840 (RAM41_06800) | - | 1391835..1392266 (+) | 432 | WP_168434019.1 | holin family protein | - |
| RAM41_RS06845 (RAM41_06805) | - | 1392279..1393226 (+) | 948 | WP_214528148.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| RAM41_RS06850 (RAM41_06810) | - | 1393432..1393779 (-) | 348 | WP_100006909.1 | hypothetical protein | - |
| RAM41_RS06855 | - | 1393776..1393928 (-) | 153 | WP_100006908.1 | ribbon-helix-helix domain-containing protein | - |
| RAM41_RS06860 (RAM41_06815) | - | 1394059..1394451 (+) | 393 | WP_110148338.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 153 a.a. Molecular weight: 16791.61 Da Isoelectric Point: 7.8486
>NTDB_id=868992 RAM41_RS06655 WP_100006931.1 1362431..1362892(+) (ssb) [Staphylococcus pseudintermedius strain CUVET16-115]
MINRVVLVGRLTKNPDLRHTPNGISVSSFTLAVNRTFTNAKGEREADFINCIAFKKTAENINNYLSKGSLAGVDGRIKSR
SYENKDGQRVYVTEVICDSVQFLESKSTNSNQSQGGIASGQYQPKTNHVAATSQNPFVNTNDSIDISDDDLPF
MINRVVLVGRLTKNPDLRHTPNGISVSSFTLAVNRTFTNAKGEREADFINCIAFKKTAENINNYLSKGSLAGVDGRIKSR
SYENKDGQRVYVTEVICDSVQFLESKSTNSNQSQGGIASGQYQPKTNHVAATSQNPFVNTNDSIDISDDDLPF
Nucleotide
Download Length: 462 bp
>NTDB_id=868992 RAM41_RS06655 WP_100006931.1 1362431..1362892(+) (ssb) [Staphylococcus pseudintermedius strain CUVET16-115]
ATGATTAATAGAGTTGTACTTGTAGGAAGATTAACTAAAAATCCTGATTTAAGACATACACCAAACGGAATAAGTGTTAG
CAGTTTCACACTTGCTGTAAATCGTACATTTACAAATGCAAAAGGTGAACGTGAAGCGGATTTTATTAACTGTATTGCCT
TTAAAAAAACAGCAGAGAACATTAATAACTACTTATCAAAAGGAAGTTTAGCAGGTGTTGATGGCCGTATAAAATCACGT
AGTTATGAAAATAAAGATGGGCAACGCGTATATGTCACAGAAGTGATTTGTGACAGTGTTCAGTTTCTTGAAAGCAAATC
TACTAATAGCAATCAATCACAAGGCGGTATAGCATCCGGACAATATCAACCAAAAACAAATCATGTCGCTGCTACAAGTC
AAAATCCATTTGTTAATACGAATGATTCAATTGATATTAGTGACGACGATTTACCATTCTAA
ATGATTAATAGAGTTGTACTTGTAGGAAGATTAACTAAAAATCCTGATTTAAGACATACACCAAACGGAATAAGTGTTAG
CAGTTTCACACTTGCTGTAAATCGTACATTTACAAATGCAAAAGGTGAACGTGAAGCGGATTTTATTAACTGTATTGCCT
TTAAAAAAACAGCAGAGAACATTAATAACTACTTATCAAAAGGAAGTTTAGCAGGTGTTGATGGCCGTATAAAATCACGT
AGTTATGAAAATAAAGATGGGCAACGCGTATATGTCACAGAAGTGATTTGTGACAGTGTTCAGTTTCTTGAAAGCAAATC
TACTAATAGCAATCAATCACAAGGCGGTATAGCATCCGGACAATATCAACCAAAAACAAATCATGTCGCTGCTACAAGTC
AAAATCCATTTGTTAATACGAATGATTCAATTGATATTAGTGACGACGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.614 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.595 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.377 |
69.281 |
0.418 |