Detailed information NTG0867167

Bioinformatically predicted

Overview

• Name: clpP
• Type: Regulator
• Locus tag: Q7W68_RS24875
• Genome accession: NZ_CP132065
• Coordinates: 4803047..4803628 (+)
• Length: 193 a.a.
• NCBI ID: WP_001049163.1
• Uniprot ID: A0A366GQ86
• Organism: Bacillus mycoides strain PAMC 29538
• Function: degradation of ComK; degradation of DegU (predicted from homology) Competence regulation

Genomic Context

Location: 4798047..4808628

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
Q7W68_RS24840	-	4799030..4799236 (+)	207	WP_000216167.1	DUF1657 domain-containing protein	-
Q7W68_RS24845	-	4799343..4799831 (+)	489	WP_305926848.1	YhcN/YlaJ family sporulation lipoprotein	-
Q7W68_RS24850	spoVAC	4799860..4800336 (+)	477	WP_002034730.1	stage V sporulation protein AC	-
Q7W68_RS24855	spoVAD	4800337..4801353 (+)	1017	WP_000938981.1	stage V sporulation protein AD	-
Q7W68_RS24860	spoVAE	4801350..4801700 (+)	351	WP_000575919.1	stage V sporulation protein AE	-
Q7W68_RS24865	-	4801710..4801916 (+)	207	WP_002034728.1	DUF1657 domain-containing protein	-
Q7W68_RS24870	-	4801937..4802806 (+)	870	WP_002016080.1	DUF421 domain-containing protein	-
Q7W68_RS24875	clpP	4803047..4803628 (+)	582	WP_001049163.1	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	Regulator
Q7W68_RS24880	-	4803696..4803872 (+)	177	WP_165762412.1	hypothetical protein	-
Q7W68_RS24885	-	4803985..4804233 (-)	249	WP_002016081.1	HPr family phosphocarrier protein	-
Q7W68_RS24890	whiA	4804257..4805207 (-)	951	WP_002016082.1	DNA-binding protein WhiA	-
Q7W68_RS24895	yvcK	4805296..4806249 (-)	954	WP_201063986.1	YvcK family protein	-
Q7W68_RS24900	rapZ	4806253..4807134 (-)	882	WP_002016084.1	RNase adapter RapZ	-
Q7W68_RS24905	-	4807155..4807613 (-)	459	WP_002124062.1	8-oxo-dGTP diphosphatase	-

Sequence

Protein

• Length: 193 a.a.
• Molecular weight: 21447.68 Da
• Isoelectric Point: 5.0423

>NTDB_id=867167 Q7W68_RS24875 WP_001049163.1 4803047..4803628(+) (clpP) [Bacillus mycoides strain PAMC 29538]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAERALEYGLIDKIFTNR

Nucleotide

• Length: 582 bp

>NTDB_id=867167 Q7W68_RS24875 WP_001049163.1 4803047..4803628(+) (clpP) [Bacillus mycoides strain PAMC 29538]
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAGGA
TCGCATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCAAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCAGAAAAAGATATTCACATTTACATCAACAGCCCTGGTGGTTCTATCACAGCTGGTATGGCAATTTACGATACA
ATGCAGTTTATTAAACCACAAGTATCAACAATCTGTATCGGTATGGCTGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTACGCACTTCCAAACAGTGAAGTTATGATTCACCAACCACTTGGCGGAGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCAAAACGTATCCTATTCTTACGTGAAAAATTAAACCAAATTCTTGCTGACCGCACAGGTCAA
CCACTTGAAGTTCTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAGAGCTCTAGAATACGGCTTAATCGA
TAAGATCTTTACAAATCGTTAA

Domains

Predicted by InterproScan.

• Clp protease (CLP_protease) (13-192)

3D structure

• AlphaFold DB: A0A366GQ86

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
clpP	Bacillus subtilis subsp. subtilis str. 168	90.104	99.482	0.896
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	67.021	97.409	0.653
clpP	Streptococcus thermophilus LMG 18311	60.417	99.482	0.601
clpP	Streptococcus thermophilus LMD-9	60.417	99.482	0.601
clpP	Lactococcus lactis subsp. cremoris KW2	58.854	99.482	0.585
clpP	Streptococcus pneumoniae D39	57.292	99.482	0.57
clpP	Streptococcus pneumoniae Rx1	57.292	99.482	0.57
clpP	Streptococcus pneumoniae R6	57.292	99.482	0.57
clpP	Streptococcus pneumoniae TIGR4	57.292	99.482	0.57
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	56.771	99.482	0.565
clpP	Streptococcus pyogenes JRS4	55.729	99.482	0.554
clpP	Streptococcus pyogenes MGAS315	55.729	99.482	0.554
clpP	Streptococcus mutans UA159	55.44	100	0.554