Detailed information
Overview
| Name | dprA | Type | Machinery gene |
| Locus tag | C694_RS01710 | Genome accession | NC_018939 |
| Coordinates | 347624..348424 (+) | Length | 266 a.a. |
| NCBI ID | WP_001862983.1 | Uniprot ID | - |
| Organism | Helicobacter pylori 26695 | ||
| Function | ssDNA binding; loading RecA onto ssDNA DNA processing |
||
Function
For both dprA mutants, the frequency of transformation by H. pylori chromosomal DNA was markedly reduced, but not eliminated, compared to their wild-type parental strains. Using Helicobacter pylori and Vibrio cholerae as model systems, it was demonstrated that ComM directly interacts with the DprA winged-helix domain, and that this interaction is critical for DprA to recruit ComM to the recombination site to promote branch migration during NT.
Genomic Context
Location: 342624..353424
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C694_RS01675 (C694_01655) | pseH | 343118..343660 (+) | 543 | WP_000742697.1 | UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase | - |
| C694_RS01680 (C694_01660) | - | 343593..344531 (-) | 939 | WP_000833936.1 | tetraacyldisaccharide 4'-kinase | - |
| C694_RS01685 (C694_01665) | - | 344528..345310 (-) | 783 | WP_001168317.1 | NAD+ synthase | - |
| C694_RS01695 (C694_01670) | ilvC | 345559..346551 (+) | 993 | WP_001207734.1 | ketol-acid reductoisomerase | - |
| C694_RS01700 (C694_01675) | minD | 346576..347382 (+) | 807 | WP_001019069.1 | septum site-determining protein MinD | - |
| C694_RS01705 (C694_01680) | minE | 347379..347612 (+) | 234 | WP_000051415.1 | cell division topological specificity factor MinE | - |
| C694_RS01710 (C694_01685) | dprA | 347624..348424 (+) | 801 | WP_001862983.1 | DNA-processing protein DprA | Machinery gene |
| C694_RS01715 (C694_01690) | dprB | 348421..348825 (+) | 405 | WP_000599146.1 | Holliday junction resolvase RuvX | Machinery gene |
| C694_RS08760 | - | 349111..349299 (+) | 189 | WP_010875464.1 | hypothetical protein | - |
| C694_RS01725 | - | 349241..349657 (+) | 417 | WP_001862988.1 | tetratricopeptide repeat protein | - |
| C694_RS01730 (C694_01710) | - | 349784..350089 (+) | 306 | WP_000699933.1 | hypothetical protein | - |
| C694_RS01735 (C694_01715) | - | 350073..350639 (+) | 567 | WP_000032376.1 | hypothetical protein | - |
| C694_RS01740 (C694_01720) | - | 350691..351047 (+) | 357 | WP_015056036.1 | glycoside hydrolase family protein | - |
| C694_RS01745 (C694_01725) | - | 351035..351301 (+) | 267 | WP_001862993.1 | hypothetical protein | - |
| C694_RS01755 (C694_01735) | - | 351607..351993 (+) | 387 | WP_000393582.1 | DUF1294 domain-containing protein | - |
| C694_RS08280 | - | 351993..352779 (+) | 787 | Protein_330 | hypothetical protein | - |
| C694_RS01770 (C694_01750) | - | 352769..353104 (+) | 336 | WP_001862999.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 266 a.a. Molecular weight: 29940.83 Da Isoelectric Point: 7.7998
MKSHFQYSTLENIPKAFDILKDPPKKLYCVGDTKLLDTPLKVAIIGTRRPTPYSKQHTITLARELAKNGAVIVSGGALGV
DIIAQENALPKTIMLSPCSLDFIYPTNNHKVIQEIAQNGLILSEYEKDFMPIKGSFLARNRLVIALSDVVIIPQADLKSG
SMSSARLAQKYQKPLFVLPQRLNESDGTNELLEKGQAQGIFNIQNFINTLLKDYHLKEMPEMEDEFLEYCAKNPSYEEAY
LKFGDKLLEYELLGKIKRINHIVVLA
Nucleotide
Download Length: 801 bp
ATGAAAAGCCACTTCCAATACAGCACGCTAGAAAATATCCCTAAAGCCTTTGACATTCTCAAAGACCCCCCTAAAAAACT
CTATTGTGTGGGCGATACCAAGCTTTTGGACACGCCTTTAAAAGTGGCGATCATAGGCACAAGAAGACCCACCCCTTACA
GCAAGCAACACACGATCACTCTAGCTAGAGAGCTTGCTAAAAATGGCGCGGTTATTGTGAGTGGGGGAGCGTTAGGCGTG
GATATTATCGCTCAAGAAAACGCCTTGCCAAAAACGATCATGCTTTCGCCTTGCAGTTTGGATTTCATCTATCCTACGAA
CAATCATAAAGTGATCCAAGAAATCGCGCAAAACGGCTTGATTTTAAGCGAATATGAAAAGGATTTCATGCCCATTAAAG
GCTCTTTTTTGGCGAGAAACCGCCTGGTGATCGCTTTAAGCGATGTGGTGATTATCCCCCAAGCGGATTTAAAAAGCGGC
TCTATGAGCAGCGCGAGATTAGCCCAGAAATACCAAAAGCCTTTATTTGTTTTACCCCAACGCCTGAATGAGAGCGATGG
CACTAATGAGCTTTTAGAAAAAGGGCAGGCTCAAGGGATATTTAATATTCAAAATTTTATAAACACCCTTTTAAAAGACT
ACCATTTAAAAGAAATGCCTGAAATGGAAGATGAATTTTTAGAATATTGTGCCAAAAACCCGAGCTATGAAGAAGCGTAT
CTCAAATTTGGGGATAAGCTTTTAGAATACGAGCTGTTGGGTAAGATCAAGCGCATCAATCACATTGTGGTGTTAGCGTG
A
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| dprA | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
48.75 |
93.385 |
0.455 |
Multiple sequence alignment
References
| [1] | Triana N Dalia et al. (2025) DprA recruits ComM to facilitate recombination during natural transformation in Gram-negative bacteria. Proceedings of The National Academy of Sciences of The United States of America 122(15):e2421764122. [PMID: 40215278] |
| [2] | Prashant P Damke et al. (2019) Identification of the periplasmic DNA receptor for natural transformation of Helicobacter pylori. Nature Communications 10(1):5357. [PMID: 31767852] |
| [3] | Gajendradhar R Dwivedi et al. (2015) Insights into the Functional Roles of N-Terminal and C-Terminal Domains of Helicobacter pylori DprA. PloS One 10(7):e0131116. [PMID: 26135134] |
| [4] | Wei Wang et al. (2014) Structural insights into the unique single-stranded DNA-binding mode of Helicobacter pylori DprA. Nucleic Acids Research 42(5):3478-91. [PMID: 24369431] |
| [5] | Gajendradhar R Dwivedi et al. (2013) Helicobacter pylori DprA alleviates restriction barrier for incoming DNA. Nucleic Acids Research 41(5):3274-88. [PMID: 23355610] |
| [6] | L C Smeets et al. (2000) The dprA gene is required for natural transformation of Helicobacter pylori. FEMS Immunology And Medical Microbiology 27(2):99-102. [PMID: 10640603] |
| [7] | T Ando et al. (1999) HP0333, a member of the dprA family, is involved in natural transformation in Helicobacter pylori. Journal of Bacteriology 181(18):5572-80. [PMID: 10482496] |