Detailed information    

experimental Experimentally validated

Overview


Name   dprA   Type   Machinery gene
Locus tag   C694_RS01710 Genome accession   NC_018939
Coordinates   347624..348424 (+) Length   266 a.a.
NCBI ID   WP_001862983.1    Uniprot ID   -
Organism   Helicobacter pylori 26695     
Function   ssDNA binding; loading RecA onto ssDNA   
DNA processing

Function


For both dprA mutants, the frequency of transformation by H. pylori chromosomal DNA was markedly reduced, but not eliminated, compared to their wild-type parental strains. Using Helicobacter pylori and Vibrio cholerae as model systems, it was demonstrated that ComM directly interacts with the DprA winged-helix domain, and that this interaction is critical for DprA to recruit ComM to the recombination site to promote branch migration during NT.


Genomic Context


Location: 342624..353424
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C694_RS01675 (C694_01655) pseH 343118..343660 (+) 543 WP_000742697.1 UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase -
  C694_RS01680 (C694_01660) - 343593..344531 (-) 939 WP_000833936.1 tetraacyldisaccharide 4'-kinase -
  C694_RS01685 (C694_01665) - 344528..345310 (-) 783 WP_001168317.1 NAD+ synthase -
  C694_RS01695 (C694_01670) ilvC 345559..346551 (+) 993 WP_001207734.1 ketol-acid reductoisomerase -
  C694_RS01700 (C694_01675) minD 346576..347382 (+) 807 WP_001019069.1 septum site-determining protein MinD -
  C694_RS01705 (C694_01680) minE 347379..347612 (+) 234 WP_000051415.1 cell division topological specificity factor MinE -
  C694_RS01710 (C694_01685) dprA 347624..348424 (+) 801 WP_001862983.1 DNA-processing protein DprA Machinery gene
  C694_RS01715 (C694_01690) dprB 348421..348825 (+) 405 WP_000599146.1 Holliday junction resolvase RuvX Machinery gene
  C694_RS08760 - 349111..349299 (+) 189 WP_010875464.1 hypothetical protein -
  C694_RS01725 - 349241..349657 (+) 417 WP_001862988.1 tetratricopeptide repeat protein -
  C694_RS01730 (C694_01710) - 349784..350089 (+) 306 WP_000699933.1 hypothetical protein -
  C694_RS01735 (C694_01715) - 350073..350639 (+) 567 WP_000032376.1 hypothetical protein -
  C694_RS01740 (C694_01720) - 350691..351047 (+) 357 WP_015056036.1 glycoside hydrolase family protein -
  C694_RS01745 (C694_01725) - 351035..351301 (+) 267 WP_001862993.1 hypothetical protein -
  C694_RS01755 (C694_01735) - 351607..351993 (+) 387 WP_000393582.1 DUF1294 domain-containing protein -
  C694_RS08280 - 351993..352779 (+) 787 Protein_330 hypothetical protein -
  C694_RS01770 (C694_01750) - 352769..353104 (+) 336 WP_001862999.1 hypothetical protein -

Sequence


Protein


Download         Length: 266 a.a.        Molecular weight: 29940.83 Da        Isoelectric Point: 7.7998

>NTDB_id=1210 C694_RS01710 WP_001862983.1 347624..348424(+) (dprA) [Helicobacter pylori 26695]
MKSHFQYSTLENIPKAFDILKDPPKKLYCVGDTKLLDTPLKVAIIGTRRPTPYSKQHTITLARELAKNGAVIVSGGALGV
DIIAQENALPKTIMLSPCSLDFIYPTNNHKVIQEIAQNGLILSEYEKDFMPIKGSFLARNRLVIALSDVVIIPQADLKSG
SMSSARLAQKYQKPLFVLPQRLNESDGTNELLEKGQAQGIFNIQNFINTLLKDYHLKEMPEMEDEFLEYCAKNPSYEEAY
LKFGDKLLEYELLGKIKRINHIVVLA

Nucleotide


Download         Length: 801 bp        

>NTDB_id=1210 C694_RS01710 WP_001862983.1 347624..348424(+) (dprA) [Helicobacter pylori 26695]
ATGAAAAGCCACTTCCAATACAGCACGCTAGAAAATATCCCTAAAGCCTTTGACATTCTCAAAGACCCCCCTAAAAAACT
CTATTGTGTGGGCGATACCAAGCTTTTGGACACGCCTTTAAAAGTGGCGATCATAGGCACAAGAAGACCCACCCCTTACA
GCAAGCAACACACGATCACTCTAGCTAGAGAGCTTGCTAAAAATGGCGCGGTTATTGTGAGTGGGGGAGCGTTAGGCGTG
GATATTATCGCTCAAGAAAACGCCTTGCCAAAAACGATCATGCTTTCGCCTTGCAGTTTGGATTTCATCTATCCTACGAA
CAATCATAAAGTGATCCAAGAAATCGCGCAAAACGGCTTGATTTTAAGCGAATATGAAAAGGATTTCATGCCCATTAAAG
GCTCTTTTTTGGCGAGAAACCGCCTGGTGATCGCTTTAAGCGATGTGGTGATTATCCCCCAAGCGGATTTAAAAAGCGGC
TCTATGAGCAGCGCGAGATTAGCCCAGAAATACCAAAAGCCTTTATTTGTTTTACCCCAACGCCTGAATGAGAGCGATGG
CACTAATGAGCTTTTAGAAAAAGGGCAGGCTCAAGGGATATTTAATATTCAAAATTTTATAAACACCCTTTTAAAAGACT
ACCATTTAAAAGAAATGCCTGAAATGGAAGATGAATTTTTAGAATATTGTGCCAAAAACCCGAGCTATGAAGAAGCGTAT
CTCAAATTTGGGGATAAGCTTTTAGAATACGAGCTGTTGGGTAAGATCAAGCGCATCAATCACATTGTGGTGTTAGCGTG
A


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819

48.75

93.385

0.455


Multiple sequence alignment    



References


[1] Triana N Dalia et al. (2025) DprA recruits ComM to facilitate recombination during natural transformation in Gram-negative bacteria. Proceedings of The National Academy of Sciences of The United States of America 122(15):e2421764122. [PMID: 40215278]
[2] Prashant P Damke et al. (2019) Identification of the periplasmic DNA receptor for natural transformation of Helicobacter pylori. Nature Communications 10(1):5357. [PMID: 31767852]
[3] Gajendradhar R Dwivedi et al. (2015) Insights into the Functional Roles of N-Terminal and C-Terminal Domains of Helicobacter pylori DprA. PloS One 10(7):e0131116. [PMID: 26135134]
[4] Wei Wang et al. (2014) Structural insights into the unique single-stranded DNA-binding mode of Helicobacter pylori DprA. Nucleic Acids Research 42(5):3478-91. [PMID: 24369431]
[5] Gajendradhar R Dwivedi et al. (2013) Helicobacter pylori DprA alleviates restriction barrier for incoming DNA. Nucleic Acids Research 41(5):3274-88. [PMID: 23355610]
[6] L C Smeets et al. (2000) The dprA gene is required for natural transformation of Helicobacter pylori. FEMS Immunology And Medical Microbiology 27(2):99-102. [PMID: 10640603]
[7] T Ando et al. (1999) HP0333, a member of the dprA family, is involved in natural transformation in Helicobacter pylori. Journal of Bacteriology 181(18):5572-80. [PMID: 10482496]