Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   Q8W18_RS15085 Genome accession   NZ_CP132058
Coordinates   2903639..2903779 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain F12-21     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2898639..2908779
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q8W18_RS15060 (Q8W18_15060) - 2898973..2899362 (-) 390 WP_003213775.1 hotdog fold thioesterase -
  Q8W18_RS15065 (Q8W18_15065) comA 2899386..2900027 (-) 642 WP_169055622.1 response regulator transcription factor Regulator
  Q8W18_RS15070 (Q8W18_15070) comP 2900108..2902399 (-) 2292 WP_306011132.1 ATP-binding protein Regulator
  Q8W18_RS15075 (Q8W18_15075) comX 2902413..2902586 (-) 174 WP_306011133.1 competence pheromone ComX -
  Q8W18_RS15080 (Q8W18_15080) - 2902564..2903487 (-) 924 WP_323639225.1 polyprenyl synthetase family protein -
  Q8W18_RS15085 (Q8W18_15085) degQ 2903639..2903779 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  Q8W18_RS15090 (Q8W18_15090) - 2904285..2904638 (+) 354 WP_034620108.1 hypothetical protein -
  Q8W18_RS15095 (Q8W18_15095) - 2904670..2905896 (-) 1227 WP_012011110.1 EAL and HDOD domain-containing protein -
  Q8W18_RS15100 (Q8W18_15100) - 2906036..2907505 (-) 1470 WP_058013789.1 nicotinate phosphoribosyltransferase -
  Q8W18_RS15105 (Q8W18_15105) - 2907523..2908074 (-) 552 WP_306011135.1 cysteine hydrolase family protein -
  Q8W18_RS15110 (Q8W18_15110) - 2908135..2908542 (-) 408 WP_144461864.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=867066 Q8W18_RS15085 WP_003213123.1 2903639..2903779(-) (degQ) [Bacillus pumilus strain F12-21]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=867066 Q8W18_RS15085 WP_003213123.1 2903639..2903779(-) (degQ) [Bacillus pumilus strain F12-21]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAGTACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696