Detailed information    

insolico Bioinformatically predicted

Overview

Name   crp   Type   Regulator
Locus tag   Q7615_RS00175 Genome accession   NZ_CP131718
Coordinates   40324..40998 (-) Length   224 a.a.
NCBI ID   WP_005647998.1    Uniprot ID   Q4QLV0
Organism   Haemophilus influenzae strain 2016S11-301     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 41916..84801 40324..40998 flank 918


Gene organization within MGE regions


Location: 40324..84801
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q7615_RS00175 (Q7615_00175) crp 40324..40998 (-) 675 WP_005647998.1 cAMP-activated global transcriptional regulator CRP Regulator
  Q7615_RS00180 (Q7615_00180) - 40983..41234 (-) 252 WP_005647999.1 YheU family protein -
  Q7615_RS00185 (Q7615_00185) slmA 41256..41912 (-) 657 WP_005648000.1 nucleoid occlusion factor SlmA -
  Q7615_RS00190 (Q7615_00190) dut 41916..42371 (-) 456 WP_005631431.1 dUTP diphosphatase -
  Q7615_RS00195 (Q7615_00195) coaBC 42419..43621 (-) 1203 WP_011272308.1 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC -
  Q7615_RS00200 (Q7615_00200) radC 43784..44450 (+) 667 Protein_39 DNA repair protein RadC -
  Q7615_RS00205 (Q7615_00205) rpmB 44664..44900 (+) 237 WP_342139800.1 50S ribosomal protein L28 -
  Q7615_RS00210 (Q7615_00210) rpmG 44912..45082 (+) 171 WP_005613503.1 50S ribosomal protein L33 -
  Q7615_RS00215 (Q7615_00215) - 45429..46793 (+) 1365 WP_005651563.1 diaminobutyrate--2-oxoglutarate transaminase -
  Q7615_RS00220 (Q7615_00220) vapB2 46940..47173 (+) 234 WP_005648011.1 type II toxin-antitoxin system antitoxin VapB2 -
  Q7615_RS00225 (Q7615_00225) vapC 47173..47571 (+) 399 WP_005651560.1 tRNA(fMet)-specific endonuclease VapC -
  Q7615_RS00230 (Q7615_00230) ddc 47591..49126 (+) 1536 WP_011272306.1 L-2,4-diaminobutyrate decarboxylase -
  Q7615_RS00235 (Q7615_00235) - 49568..49831 (+) 264 WP_032823788.1 hypothetical protein -
  Q7615_RS00240 (Q7615_00240) - 49871..50716 (-) 846 WP_042602938.1 hypothetical protein -
  Q7615_RS00245 (Q7615_00245) - 50777..50896 (-) 120 WP_005641687.1 Com family DNA-binding transcriptional regulator -
  Q7615_RS00250 (Q7615_00250) - 51072..51560 (-) 489 WP_105872519.1 enoyl-CoA hydratase -
  Q7615_RS00255 (Q7615_00255) - 51553..52179 (-) 627 WP_105886750.1 hypothetical protein -
  Q7615_RS00260 (Q7615_00260) - 52182..53882 (-) 1701 WP_105886749.1 phage tail protein -
  Q7615_RS00265 (Q7615_00265) - 53897..54475 (-) 579 WP_032823797.1 putative phage tail protein -
  Q7615_RS00270 (Q7615_00270) - 54475..55539 (-) 1065 WP_032823799.1 baseplate J/gp47 family protein -
  Q7615_RS00275 (Q7615_00275) - 55554..55904 (-) 351 WP_032823801.1 phage GP46 family protein -
  Q7615_RS00280 (Q7615_00280) - 55971..56606 (-) 636 WP_032823803.1 phage baseplate assembly protein V -
  Q7615_RS00285 (Q7615_00285) - 56608..57726 (-) 1119 WP_032823804.1 phage baseplate assembly protein -
  Q7615_RS00290 (Q7615_00290) - 57710..59101 (-) 1392 WP_032823805.1 DNA circularization N-terminal domain-containing protein -
  Q7615_RS00295 (Q7615_00295) - 59104..61374 (-) 2271 WP_032823806.1 phage tail tape measure protein -
  Q7615_RS00300 (Q7615_00300) - 61651..61998 (-) 348 WP_032823807.1 hypothetical protein -
  Q7615_RS00305 (Q7615_00305) - 61998..62366 (-) 369 WP_032823809.1 phage tail tube protein -
  Q7615_RS00310 (Q7615_00310) - 62376..63785 (-) 1410 WP_105892664.1 phage tail sheath subtilisin-like domain-containing protein -
  Q7615_RS00315 (Q7615_00315) - 63778..63954 (-) 177 WP_080279438.1 DUF2635 domain-containing protein -
  Q7615_RS00320 (Q7615_00320) - 63951..64595 (-) 645 WP_032823812.1 DUF1834 family protein -
  Q7615_RS00325 (Q7615_00325) - 64579..65001 (-) 423 WP_032823813.1 phage protein Gp36 family protein -
  Q7615_RS00330 (Q7615_00330) - 65005..65310 (-) 306 WP_032823815.1 hypothetical protein -
  Q7615_RS00335 (Q7615_00335) - 65346..66266 (-) 921 WP_105886746.1 Mu-like prophage major head subunit gpT family protein -
  Q7615_RS00340 (Q7615_00340) - 66266..67315 (-) 1050 WP_342139811.1 phage protease -
  Q7615_RS00345 (Q7615_00345) - 67569..68054 (-) 486 WP_032823819.1 phage virion morphogenesis protein -
  Q7615_RS00350 (Q7615_00350) - 68165..69442 (-) 1278 WP_032823821.1 phage minor head protein -
  Q7615_RS00355 (Q7615_00355) - 69429..71066 (-) 1638 WP_105886744.1 DUF935 family protein -
  Q7615_RS00360 (Q7615_00360) terL 71069..72712 (-) 1644 WP_032823822.1 phage terminase large subunit -
  Q7615_RS00365 (Q7615_00365) - 72862..73362 (-) 501 WP_032823823.1 DUF1804 family protein -
  Q7615_RS00370 (Q7615_00370) - 73364..73630 (-) 267 WP_032823824.1 hypothetical protein -
  Q7615_RS00375 (Q7615_00375) - 73630..73887 (-) 258 WP_005684166.1 hypothetical protein -
  Q7615_RS00380 (Q7615_00380) - 74011..74268 (-) 258 WP_032823825.1 DUF2681 domain-containing protein -
  Q7615_RS00385 (Q7615_00385) - 74268..74558 (-) 291 WP_032823827.1 DUF2644 domain-containing protein -
  Q7615_RS00390 (Q7615_00390) - 74555..74722 (-) 168 WP_162877568.1 hypothetical protein -
  Q7615_RS00395 (Q7615_00395) - 74712..75215 (-) 504 WP_105892707.1 glycoside hydrolase family 108 protein -
  Q7615_RS00400 (Q7615_00400) - 75309..75734 (-) 426 WP_032823829.1 Mor transcription activator family protein -
  Q7615_RS00405 (Q7615_00405) - 75847..76356 (-) 510 WP_032823830.1 hypothetical protein -
  Q7615_RS00410 (Q7615_00410) - 76416..76817 (-) 402 WP_032823831.1 regulatory protein GemA -
  Q7615_RS00415 (Q7615_00415) - 76807..77355 (-) 549 WP_032823833.1 hypothetical protein -
  Q7615_RS00420 (Q7615_00420) - 77565..77759 (-) 195 WP_239991914.1 hypothetical protein -
  Q7615_RS00425 (Q7615_00425) - 77763..77993 (-) 231 WP_061723903.1 DUF551 domain-containing protein -
  Q7615_RS00430 (Q7615_00430) - 77994..78368 (-) 375 WP_061723902.1 hypothetical protein -
  Q7615_RS00435 (Q7615_00435) - 78477..78857 (-) 381 WP_050438483.1 hypothetical protein -
  Q7615_RS00440 (Q7615_00440) - 78860..79033 (-) 174 WP_061723901.1 hypothetical protein -
  Q7615_RS00445 (Q7615_00445) - 79030..79194 (-) 165 WP_006996622.1 hypothetical protein -
  Q7615_RS00450 (Q7615_00450) - 79204..79401 (-) 198 WP_006996621.1 ANR family transcriptional regulator -
  Q7615_RS00455 (Q7615_00455) - 79587..80204 (-) 618 WP_032823840.1 DUF3164 family protein -
  Q7615_RS00460 (Q7615_00460) - 80205..80396 (-) 192 WP_005647090.1 HTH domain-containing protein -
  Q7615_RS00465 (Q7615_00465) - 80405..80701 (-) 297 WP_032823841.1 hypothetical protein -
  Q7615_RS00470 (Q7615_00470) - 80712..81593 (-) 882 WP_032823842.1 AAA family ATPase -
  Q7615_RS00475 (Q7615_00475) - 81605..83587 (-) 1983 WP_032823843.1 Mu transposase C-terminal domain-containing protein -
  Q7615_RS00480 (Q7615_00480) - 83631..83909 (-) 279 WP_105892708.1 helix-turn-helix domain-containing protein -
  Q7615_RS00485 (Q7615_00485) - 84085..84801 (+) 717 WP_032823845.1 S24 family peptidase -

Sequence

Protein


Download         Length: 224 a.a.        Molecular weight: 25151.85 Da        Isoelectric Point: 6.8375

>NTDB_id=864629 Q7615_RS00175 WP_005647998.1 40324..40998(-) (crp) [Haemophilus influenzae strain 2016S11-301]
MSNELTEIDEVVTSSQEEATQRDPVLDWFLTHCHLHKYPAKSTLIHAGEDATTLYYVIKGSVMVSSKDDEGKEMILTYLG
AGQFFGEAGLFDEGSKRSAWVKTKTTCEIAEISYKKYRQLIQANPEILMFLTAQLARRLQNTSRQVTNLAFLDVAGRIAQ
TLMNLAKQPEAMTHPDGMQIKITRQEIGQMVGCSRETVGRIIKMLEDQNLIHAHGKTIVVYGAR

Nucleotide


Download         Length: 675 bp        

>NTDB_id=864629 Q7615_RS00175 WP_005647998.1 40324..40998(-) (crp) [Haemophilus influenzae strain 2016S11-301]
ATGTCAAATGAATTAACCGAAATTGATGAAGTTGTAACCTCCTCTCAAGAAGAAGCAACTCAACGAGATCCCGTTTTAGA
TTGGTTTCTTACTCACTGCCATTTGCATAAATATCCTGCAAAATCAACTTTAATTCATGCTGGGGAAGATGCGACCACGC
TGTATTATGTAATTAAAGGTTCTGTAATGGTATCTTCAAAAGATGATGAAGGCAAAGAGATGATCCTCACTTACTTAGGA
GCAGGACAATTTTTTGGCGAAGCGGGATTATTTGATGAAGGTTCAAAACGATCAGCTTGGGTAAAAACAAAAACAACATG
TGAAATTGCTGAAATTTCCTATAAGAAATATCGCCAGTTGATTCAGGCAAACCCTGAAATCTTAATGTTTCTCACTGCAC
AATTGGCAAGACGTTTGCAAAATACATCACGTCAAGTCACGAATTTGGCATTTTTAGACGTCGCAGGTCGCATCGCTCAA
ACTTTAATGAACTTAGCTAAACAGCCTGAAGCAATGACGCATCCTGATGGTATGCAAATCAAAATTACACGCCAAGAAAT
AGGGCAAATGGTGGGTTGTTCACGAGAAACTGTGGGGCGCATTATTAAGATGTTGGAGGATCAGAATCTTATCCACGCTC
ATGGAAAAACAATCGTTGTATATGGCGCAAGATAA

Domains

Predicted by InterproScan.

Cyclic nucleotide-binding domain (cNMP_binding)

(36-124)

Crp-like helix-turn-helix domain (HTH_Crp_2)

(156-220)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q4QLV0

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  crp Haemophilus influenzae Rd KW20

100

100

1
  crp Vibrio cholerae strain A1552

75.49

91.071

0.687
  crp Acinetobacter baumannii D1279779

48.705

86.161

0.42