Detailed information NTG0086425

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: KJS48_RS11525
• Genome accession: NZ_AP024603
• Coordinates: 2427323..2427760 (-)
• Length: 145 a.a.
• NCBI ID: WP_007612572.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain KOF112
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2422323..2432760

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
KJS48_RS11475 (KOF112_22130)	sinI	2422706..2422879 (+)	174	WP_032874029.1	anti-repressor SinI	Regulator
KJS48_RS11480 (KOF112_22140)	sinR	2422913..2423248 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
KJS48_RS11485 (KOF112_22150)	tasA	2423296..2424081 (-)	786	WP_032874027.1	biofilm matrix protein TasA	-
KJS48_RS11490 (KOF112_22160)	sipW	2424146..2424730 (-)	585	WP_032874025.1	signal peptidase I SipW	-
KJS48_RS11495 (KOF112_22170)	tapA	2424702..2425373 (-)	672	WP_032874023.1	amyloid fiber anchoring/assembly protein TapA	-
KJS48_RS11500 (KOF112_22180)	-	2425632..2425961 (+)	330	WP_032874021.1	DUF3889 domain-containing protein	-
KJS48_RS11505 (KOF112_22190)	-	2426002..2426181 (-)	180	WP_022552966.1	YqzE family protein	-
KJS48_RS11510 (KOF112_22200)	comGG	2426238..2426615 (-)	378	WP_032874019.1	competence type IV pilus minor pilin ComGG	Machinery gene
KJS48_RS11515 (KOF112_22210)	comGF	2426616..2427080 (-)	465	WP_223813077.1	competence type IV pilus minor pilin ComGF	-
KJS48_RS11520 (KOF112_22220)	comGE	2427025..2427339 (-)	315	WP_032874016.1	competence type IV pilus minor pilin ComGE	Machinery gene
KJS48_RS11525 (KOF112_22230)	comGD	2427323..2427760 (-)	438	WP_007612572.1	competence type IV pilus minor pilin ComGD	Machinery gene
KJS48_RS11530 (KOF112_22240)	comGC	2427750..2428058 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
KJS48_RS11535 (KOF112_22250)	comGB	2428063..2429100 (-)	1038	WP_032874014.1	competence type IV pilus assembly protein ComGB	Machinery gene
KJS48_RS11540 (KOF112_22260)	comGA	2429087..2430157 (-)	1071	WP_003153083.1	competence type IV pilus ATPase ComGA	Machinery gene
KJS48_RS11545 (KOF112_22270)	-	2430354..2431304 (-)	951	WP_032874012.1	magnesium transporter CorA family protein	-
KJS48_RS11550 (KOF112_22280)	-	2431450..2432751 (+)	1302	WP_032874010.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16254.76 Da
• Isoelectric Point: 10.1850

>NTDB_id=86425 KJS48_RS11525 WP_007612572.1 2427323..2427760(-) (comGD) [Bacillus velezensis strain KOF112]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=86425 KJS48_RS11525 WP_007612572.1 2427323..2427760(-) (comGD) [Bacillus velezensis strain KOF112]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCATATTACACTTGTAACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	55.479	100	0.559