Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KJS48_RS11475 Genome accession   NZ_AP024603
Coordinates   2422706..2422879 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain KOF112     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2417706..2427879
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJS48_RS11460 (KOF112_22100) gcvT 2418520..2419620 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  KJS48_RS11465 (KOF112_22110) - 2420043..2421713 (+) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  KJS48_RS11470 (KOF112_22120) - 2421735..2422529 (+) 795 WP_007612541.1 YqhG family protein -
  KJS48_RS11475 (KOF112_22130) sinI 2422706..2422879 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  KJS48_RS11480 (KOF112_22140) sinR 2422913..2423248 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KJS48_RS11485 (KOF112_22150) tasA 2423296..2424081 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  KJS48_RS11490 (KOF112_22160) sipW 2424146..2424730 (-) 585 WP_032874025.1 signal peptidase I SipW -
  KJS48_RS11495 (KOF112_22170) tapA 2424702..2425373 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  KJS48_RS11500 (KOF112_22180) - 2425632..2425961 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  KJS48_RS11505 (KOF112_22190) - 2426002..2426181 (-) 180 WP_022552966.1 YqzE family protein -
  KJS48_RS11510 (KOF112_22200) comGG 2426238..2426615 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  KJS48_RS11515 (KOF112_22210) comGF 2426616..2427080 (-) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  KJS48_RS11520 (KOF112_22220) comGE 2427025..2427339 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  KJS48_RS11525 (KOF112_22230) comGD 2427323..2427760 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=86421 KJS48_RS11475 WP_032874029.1 2422706..2422879(+) (sinI) [Bacillus velezensis strain KOF112]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=86421 KJS48_RS11475 WP_032874029.1 2422706..2422879(+) (sinI) [Bacillus velezensis strain KOF112]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment