Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   KJS48_RS11510 Genome accession   NZ_AP024603
Coordinates   2426238..2426615 (-) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain KOF112     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2421238..2431615
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJS48_RS11470 (KOF112_22120) - 2421735..2422529 (+) 795 WP_007612541.1 YqhG family protein -
  KJS48_RS11475 (KOF112_22130) sinI 2422706..2422879 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  KJS48_RS11480 (KOF112_22140) sinR 2422913..2423248 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KJS48_RS11485 (KOF112_22150) tasA 2423296..2424081 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  KJS48_RS11490 (KOF112_22160) sipW 2424146..2424730 (-) 585 WP_032874025.1 signal peptidase I SipW -
  KJS48_RS11495 (KOF112_22170) tapA 2424702..2425373 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  KJS48_RS11500 (KOF112_22180) - 2425632..2425961 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  KJS48_RS11505 (KOF112_22190) - 2426002..2426181 (-) 180 WP_022552966.1 YqzE family protein -
  KJS48_RS11510 (KOF112_22200) comGG 2426238..2426615 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  KJS48_RS11515 (KOF112_22210) comGF 2426616..2427080 (-) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  KJS48_RS11520 (KOF112_22220) comGE 2427025..2427339 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  KJS48_RS11525 (KOF112_22230) comGD 2427323..2427760 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  KJS48_RS11530 (KOF112_22240) comGC 2427750..2428058 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  KJS48_RS11535 (KOF112_22250) comGB 2428063..2429100 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  KJS48_RS11540 (KOF112_22260) comGA 2429087..2430157 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  KJS48_RS11545 (KOF112_22270) - 2430354..2431304 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=86423 KJS48_RS11510 WP_032874019.1 2426238..2426615(-) (comGG) [Bacillus velezensis strain KOF112]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=86423 KJS48_RS11510 WP_032874019.1 2426238..2426615(-) (comGG) [Bacillus velezensis strain KOF112]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488

Multiple sequence alignment