Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   CPY3401_RS00735 Genome accession   NZ_AP024599
Coordinates   156408..156533 (+) Length   41 a.a.
NCBI ID   WP_120902658.1    Uniprot ID   -
Organism   Helicobacter pylori strain 3401     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 151408..161533
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CPY3401_RS00710 (CPY3401_01410) - 151468..153690 (+) 2223 WP_221062569.1 AAA family ATPase -
  CPY3401_RS00715 (CPY3401_01420) panD 153680..154030 (+) 351 WP_180440147.1 aspartate 1-decarboxylase -
  CPY3401_RS00720 (CPY3401_01430) - 154041..154334 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  CPY3401_RS00725 (CPY3401_01440) - 154334..155329 (+) 996 WP_221062863.1 PDZ domain-containing protein -
  CPY3401_RS00730 (CPY3401_01450) comB6 155337..156392 (+) 1056 WP_221062862.1 P-type conjugative transfer protein TrbL Machinery gene
  CPY3401_RS00735 comB7 156408..156533 (+) 126 WP_120902658.1 comB7 lipoprotein Machinery gene
  CPY3401_RS00740 (CPY3401_01460) comB8 156530..157273 (+) 744 WP_221062570.1 type IV secretion system protein Machinery gene
  CPY3401_RS00745 (CPY3401_01470) comB9 157273..158235 (+) 963 WP_221062571.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  CPY3401_RS00750 (CPY3401_01480) comB10 158228..159364 (+) 1137 WP_221062572.1 DNA type IV secretion system protein ComB10 Machinery gene
  CPY3401_RS00755 (CPY3401_01490) - 159430..160842 (+) 1413 WP_221062573.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4812.85 Da        Isoelectric Point: 9.3278

>NTDB_id=86326 CPY3401_RS00735 WP_120902658.1 156408..156533(+) (comB7) [Helicobacter pylori strain 3401]
MRIFFVIMGLILFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=86326 CPY3401_RS00735 WP_120902658.1 156408..156533(+) (comB7) [Helicobacter pylori strain 3401]
ATGAGAATTTTTTTTGTCATTATGGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854

Multiple sequence alignment